Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013253045 1100 bp mRNA linear INV 02-SEP-2023 ACCESSION XM_013253045 VERSION XM_013253045.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013253045.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1100 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1100 /gene="LOC106087855" /note="tetraspanin-2A; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins" /db_xref="GeneID:106087855" CDS 140..865 /gene="LOC106087855" /codon_start=1 /product="tetraspanin-2A" /protein_id="XP_013108499.1" /db_xref="GeneID:106087855" /translation="MATTTENSLEKQIGCIKYTLFCFNIIAWMLATSLFALTVWLRAE PGFNEWLKILEAESFYIGVYILIGISIIMMAVSFLGCLSALMENTLALFVFIGTQIFG FIATIAGSALLLEYSTMHSSLQPLLQVSISRFVSSSETPYSSYVLNMIQENIGCCGAS GPWDYLNLRQPLPSSCRDAVSGNCFFNGCVDELTWFFEGKSTWIVAIALALGMLNVIC GVMSLALVQAVKKEEEEVQAYRR" misc_feature 185..820 /gene="LOC106087855" /note="Tetraspanin family; Region: Tetraspanin; pfam00335" /db_xref="CDD:459767" ORIGIN 1 acctttgcta tgagtaaatg aacattcaaa acgaatttta cttttaacga attgcgaacg 61 acaaaaaagt tttaaaagaa aacaagcggc gggtgggagt tttaaaagaa aattaaatta 121 ttttaaagat taattcaata tggccaccac cacagaaaat agtttggaaa aacaaatagg 181 ttgcataaaa tataccctat tctgtttcaa catcatagcc tggatgttag ccacctcgtt 241 gtttgcccta actgtctggc taagagctga gcctggtttc aatgaatggt tgaaaatttt 301 agaagctgaa tcattttaca ttggtgtcta cattttaatt ggcataagta tcatcatgat 361 ggctgttagc tttttgggct gtctttctgc cctaatggaa aacactttgg ctctatttgt 421 gtttatcgga actcaaatct ttggttttat agccaccata gcgggttcgg ctttactgct 481 ggaatacagc accatgcatt ccagcttaca acctctgctg caagtcagta taagccgttt 541 tgtcagctct tcggaaacac cctattcctc atatgtattg aatatgatac aagaaaacat 601 tggttgctgt ggtgccagtg gtccctggga ctatttgaat ttgcgccaac ccttgcccag 661 ttcctgtcgt gatgctgtca gtggtaattg tttctttaat ggctgtgtgg atgagctgac 721 ctggtttttc gaaggcaaat ccacttggat agtggccatt gccttggcct tgggtatgct 781 taacgttata tgtggcgtca tgagtttggc tttggtacaa gccgtcaaga aggaggagga 841 agaagtgcaa gcctatagac gttaacccac gaaagcttga agaagggagt tagctctctt 901 tcattttaca ttaaaaaaaa gttgccatcg attacttttc ctcttcacac acaacacaac 961 acatgccata cgaactggtt ttacaaaata ctgcatgtaa ttttatgcat taattaatta 1021 ttaagttcaa attgtttttt ttatttttta caaatatttg ataactgaat atttgaatat 1081 aaaatccaaa aaataaaaat