Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans tetraspanin-2A (LOC106087855), mRNA.


LOCUS       XM_013253045            1100 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_013253045
VERSION     XM_013253045.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013253045.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1100
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1100
                     /gene="LOC106087855"
                     /note="tetraspanin-2A; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 9 Proteins"
                     /db_xref="GeneID:106087855"
     CDS             140..865
                     /gene="LOC106087855"
                     /codon_start=1
                     /product="tetraspanin-2A"
                     /protein_id="XP_013108499.1"
                     /db_xref="GeneID:106087855"
                     /translation="MATTTENSLEKQIGCIKYTLFCFNIIAWMLATSLFALTVWLRAE
                     PGFNEWLKILEAESFYIGVYILIGISIIMMAVSFLGCLSALMENTLALFVFIGTQIFG
                     FIATIAGSALLLEYSTMHSSLQPLLQVSISRFVSSSETPYSSYVLNMIQENIGCCGAS
                     GPWDYLNLRQPLPSSCRDAVSGNCFFNGCVDELTWFFEGKSTWIVAIALALGMLNVIC
                     GVMSLALVQAVKKEEEEVQAYRR"
     misc_feature    185..820
                     /gene="LOC106087855"
                     /note="Tetraspanin family; Region: Tetraspanin; pfam00335"
                     /db_xref="CDD:459767"
ORIGIN      
        1 acctttgcta tgagtaaatg aacattcaaa acgaatttta cttttaacga attgcgaacg
       61 acaaaaaagt tttaaaagaa aacaagcggc gggtgggagt tttaaaagaa aattaaatta
      121 ttttaaagat taattcaata tggccaccac cacagaaaat agtttggaaa aacaaatagg
      181 ttgcataaaa tataccctat tctgtttcaa catcatagcc tggatgttag ccacctcgtt
      241 gtttgcccta actgtctggc taagagctga gcctggtttc aatgaatggt tgaaaatttt
      301 agaagctgaa tcattttaca ttggtgtcta cattttaatt ggcataagta tcatcatgat
      361 ggctgttagc tttttgggct gtctttctgc cctaatggaa aacactttgg ctctatttgt
      421 gtttatcgga actcaaatct ttggttttat agccaccata gcgggttcgg ctttactgct
      481 ggaatacagc accatgcatt ccagcttaca acctctgctg caagtcagta taagccgttt
      541 tgtcagctct tcggaaacac cctattcctc atatgtattg aatatgatac aagaaaacat
      601 tggttgctgt ggtgccagtg gtccctggga ctatttgaat ttgcgccaac ccttgcccag
      661 ttcctgtcgt gatgctgtca gtggtaattg tttctttaat ggctgtgtgg atgagctgac
      721 ctggtttttc gaaggcaaat ccacttggat agtggccatt gccttggcct tgggtatgct
      781 taacgttata tgtggcgtca tgagtttggc tttggtacaa gccgtcaaga aggaggagga
      841 agaagtgcaa gcctatagac gttaacccac gaaagcttga agaagggagt tagctctctt
      901 tcattttaca ttaaaaaaaa gttgccatcg attacttttc ctcttcacac acaacacaac
      961 acatgccata cgaactggtt ttacaaaata ctgcatgtaa ttttatgcat taattaatta
     1021 ttaagttcaa attgtttttt ttatttttta caaatatttg ataactgaat atttgaatat
     1081 aaaatccaaa aaataaaaat