Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106087853


LOCUS       XM_013253042             935 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087853), mRNA.
ACCESSION   XM_013253042
VERSION     XM_013253042.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013253042.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..935
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..935
                     /gene="LOC106087853"
                     /note="uncharacterized LOC106087853; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106087853"
     CDS             61..867
                     /gene="LOC106087853"
                     /codon_start=1
                     /product="uncharacterized protein LOC106087853"
                     /protein_id="XP_013108496.2"
                     /db_xref="GeneID:106087853"
                     /translation="MPSIIFSRQLFLLLLALPLNIMAGPVSNPEVASKSAKANTIQQQ
                     QQQQTNQQPKPQDAHLNTLSVYANNYDFLSGNNQNSLNNGEQFKPSYKLPDMETNFTP
                     IQNSNSIAPEFTAPAPVLMQYLPQTITEGGMQYLQLIPTRPLVVPIGPYLTSGATAPS
                     LGYTQTISAGHPLEYSARANAMLSTMPVNIPPPVPTSLVEVPSQPLPAYGIPSYAAHL
                     QAPKQNYRINRETKDRHLPGPLNLNLNEYMPGPGQPQTPMQQAGFVRGRP"
ORIGIN      
        1 ctaatctttc caatttttta gatttggttt tattacagaa cggaagtaac caactccatc
       61 atgccttcaa tcatattttc tcgtcaatta tttctgcttc tattggcctt accgctcaat
      121 ataatggctg gacctgtgtc taatccagaa gttgccagta agtcagcaaa agccaataca
      181 atccaacaac aacaacaaca acaaacaaat cagcaaccaa aaccccaaga tgctcatctc
      241 aataccttaa gtgtgtatgc caataattat gattttctaa gcggcaataa tcaaaattcc
      301 cttaataatg gtgaacaatt taaaccctca tacaagctac ccgatatgga aacaaatttt
      361 acacccatac aaaattctaa tagtatagcg ccagaattta cagctccagc accggtgctg
      421 atgcaatatc tgccacaaac aatcaccgaa ggtggtatgc agtatttgca attgataccc
      481 acaagacctt tggtggtacc cataggtccc tatttgacaa gtggtgccac ggctccttca
      541 ttgggttata cacaaaccat aagtgctgga catcccttgg aatattcggc aagagccaat
      601 gccatgctgt caacaatgcc cgtgaatatt ccaccaccag ttcccacatc attggtggaa
      661 gttccttcgc aaccattacc agcctatgga ataccctcct atgctgctca tttgcaagca
      721 cccaaacaaa attatcgcat aaatcgtgag accaaagaca gacatctgcc aggaccctta
      781 aatttgaatt taaatgaata tatgccagga cctggacaac cacaaactcc aatgcaacag
      841 gctggttttg taaggggaag accttaaaca tatgtaacac agagctaaca aagtagttaa
      901 aaatccaaaa ccaaatttat ttttataatt attta