Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013253042 935 bp mRNA linear INV 02-SEP-2023 (LOC106087853), mRNA. ACCESSION XM_013253042 VERSION XM_013253042.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013253042.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..935 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..935 /gene="LOC106087853" /note="uncharacterized LOC106087853; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106087853" CDS 61..867 /gene="LOC106087853" /codon_start=1 /product="uncharacterized protein LOC106087853" /protein_id="XP_013108496.2" /db_xref="GeneID:106087853" /translation="MPSIIFSRQLFLLLLALPLNIMAGPVSNPEVASKSAKANTIQQQ QQQQTNQQPKPQDAHLNTLSVYANNYDFLSGNNQNSLNNGEQFKPSYKLPDMETNFTP IQNSNSIAPEFTAPAPVLMQYLPQTITEGGMQYLQLIPTRPLVVPIGPYLTSGATAPS LGYTQTISAGHPLEYSARANAMLSTMPVNIPPPVPTSLVEVPSQPLPAYGIPSYAAHL QAPKQNYRINRETKDRHLPGPLNLNLNEYMPGPGQPQTPMQQAGFVRGRP" ORIGIN 1 ctaatctttc caatttttta gatttggttt tattacagaa cggaagtaac caactccatc 61 atgccttcaa tcatattttc tcgtcaatta tttctgcttc tattggcctt accgctcaat 121 ataatggctg gacctgtgtc taatccagaa gttgccagta agtcagcaaa agccaataca 181 atccaacaac aacaacaaca acaaacaaat cagcaaccaa aaccccaaga tgctcatctc 241 aataccttaa gtgtgtatgc caataattat gattttctaa gcggcaataa tcaaaattcc 301 cttaataatg gtgaacaatt taaaccctca tacaagctac ccgatatgga aacaaatttt 361 acacccatac aaaattctaa tagtatagcg ccagaattta cagctccagc accggtgctg 421 atgcaatatc tgccacaaac aatcaccgaa ggtggtatgc agtatttgca attgataccc 481 acaagacctt tggtggtacc cataggtccc tatttgacaa gtggtgccac ggctccttca 541 ttgggttata cacaaaccat aagtgctgga catcccttgg aatattcggc aagagccaat 601 gccatgctgt caacaatgcc cgtgaatatt ccaccaccag ttcccacatc attggtggaa 661 gttccttcgc aaccattacc agcctatgga ataccctcct atgctgctca tttgcaagca 721 cccaaacaaa attatcgcat aaatcgtgag accaaagaca gacatctgcc aggaccctta 781 aatttgaatt taaatgaata tatgccagga cctggacaac cacaaactcc aatgcaacag 841 gctggttttg taaggggaag accttaaaca tatgtaacac agagctaaca aagtagttaa 901 aaatccaaaa ccaaatttat ttttataatt attta