Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans transcription initiation factor


LOCUS       XM_013252787            1083 bp    mRNA    linear   INV 02-SEP-2023
            TFIID subunit 8 (LOC106087661), transcript variant X3, mRNA.
ACCESSION   XM_013252787
VERSION     XM_013252787.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252787.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1083
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1083
                     /gene="LOC106087661"
                     /note="transcription initiation factor TFIID subunit 8;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 7 Proteins"
                     /db_xref="GeneID:106087661"
     CDS             94..1068
                     /gene="LOC106087661"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit 8
                     isoform X3"
                     /protein_id="XP_013108241.1"
                     /db_xref="GeneID:106087661"
                     /translation="MEKADCTQPTTGNARRKILSVAVSQILMEKGFDSVDKECLETLT
                     EMLQSLLVEVGQSARSYCELSGRTIPVVGDVVVALVNMGVSLQGIENFAKREGRQIIS
                     MPPQQQQQKQLNLLQAGTKSHHPPHILPYLPLFPDPHAYVRTPTHKQPVTEYEAIREK
                     AATQKRDIEKALTKFLAKTSETHSLFDTEDNMFPLIACKPAFPTYLAALNPTDQVFDF
                     EELEYHYLVANRTEDCKDEDDNESGNEEEGASNDNGGGSGSAGGDEPEKKSEKTEKET
                     KPENDIKPNSTTNKAILENPNIDSISNPYLRAATLPKRAKPDPLGGQS"
     misc_feature    133..378
                     /gene="LOC106087661"
                     /note="histone-fold domain found in transcription
                     initiation factor TFIID subunit 8 (TAF8) and similar
                     proteins; Region: HFD_TAF8; cd22918"
                     /db_xref="CDD:467043"
     misc_feature    order(133..135,163..165,187..198,268..270,274..276,
                     280..285,292..294,304..306,334..336)
                     /gene="LOC106087661"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467043"
     misc_feature    order(136..138,145..150,157..162,166..174,181..192,
                     199..201,205..210,217..222,229..237,241..249,253..261,
                     265..270,277..279,301..309,316..321,328..330,343..345,
                     349..351,355..363,367..378)
                     /gene="LOC106087661"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467043"
     misc_feature    469..630
                     /gene="LOC106087661"
                     /note="TATA Binding Protein (TBP) Associated Factor 8;
                     Region: TAF8; cd08049"
                     /db_xref="CDD:176263"
ORIGIN      
        1 cgatatggca acgttttcat tataataatt gtgattgtta aaatattaaa agttaaattt
       61 gataaacaaa tagtaaagta gttttacttt aaaatggaaa aggcggattg tacgcagcct
      121 actacgggca atgccagacg taaaattctg agcgtggcag tttcacaaat tctaatggaa
      181 aaaggatttg acagtgtaga caaagagtgc ttggaaacac tgactgaaat gttacaaagt
      241 ttattggtag aggtaggtca atcagctaga agctattgtg agctgtcggg tcgcactata
      301 cctgttgtgg gcgatgtagt tgttgcgctg gtaaatatgg gagtatcgct gcagggtatt
      361 gagaactttg ccaaacgaga gggaaggcaa ataatatcaa tgcctccgca gcagcaacaa
      421 cagaaacaat tgaatctttt acaagcagga actaaatctc accatccccc acatattctg
      481 ccctatttgc cactttttcc tgacccacat gcttatgtca ggacaccgac gcacaaacaa
      541 ccagttaccg aatatgaagc tatacgagaa aaggcagcaa cacaaaaacg tgatatagaa
      601 aaagcgctga caaaattttt ggccaaaaca tcagagactc atagcctttt cgatacagag
      661 gataatatgt ttccattaat tgcatgcaaa cctgcattcc caacttattt ggctgctttg
      721 aatccaaccg atcaagtatt tgactttgaa gagttggaat atcattattt agtagcaaac
      781 agaacagaag attgcaagga cgaggacgat aatgaaagtg gtaatgagga agaaggcgct
      841 agcaatgata atggtggagg tagtggcagc gctggagggg acgaacccga aaagaaatca
      901 gaaaagactg aaaaagaaac gaaacccgaa aatgatatca aacctaattc caccacaaat
      961 aaagccattc tggaaaatcc caacattgat tccatttcga atccttattt acgagcggct
     1021 actttgccga aacgagccaa accagatcct ttaggaggcc agtcataacg tggtctgcca
     1081 tcg