Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013252785 1362 bp mRNA linear INV 02-SEP-2023 TFIID subunit 8 (LOC106087661), transcript variant X1, mRNA. ACCESSION XM_013252785 VERSION XM_013252785.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013252785.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1362 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1362 /gene="LOC106087661" /note="transcription initiation factor TFIID subunit 8; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106087661" CDS 95..1123 /gene="LOC106087661" /codon_start=1 /product="transcription initiation factor TFIID subunit 8 isoform X1" /protein_id="XP_013108239.1" /db_xref="GeneID:106087661" /translation="MEKADCTQPTTGNARRKILSVAVSQILMEKGFDSVDKECLETLT EMLQSLLVEVGQSARSYCELSGRTIPVVGDVVVALVNMGVSLQGIENFAKREGRQIIS MPPQQQQQKQLNLLQAGTKSHHPPHILPYLPLFPDPHAYVRTPTHKQPVTEYEAIREK AATQKRDIEKALTKFLAKTSETHSLFDTEDNMFPLIACKPAFPTYLAALNPTDQVFDF EELEYHYLVANRTEDCKDEDDNESGNEEEGASNDNGGGSGSAGGDEPEKKSEKTEKET KPENDIKPNSTTNKAILENPNIDSISNPYLRAATLPKRAKPDPLDPPYSVCIYYVFHI ISDIGGQS" misc_feature 134..379 /gene="LOC106087661" /note="histone-fold domain found in transcription initiation factor TFIID subunit 8 (TAF8) and similar proteins; Region: HFD_TAF8; cd22918" /db_xref="CDD:467043" misc_feature order(134..136,164..166,188..199,269..271,275..277, 281..286,293..295,305..307,335..337) /gene="LOC106087661" /note="oligomer interface [polypeptide binding]; other site" /db_xref="CDD:467043" misc_feature order(137..139,146..151,158..163,167..175,182..193, 200..202,206..211,218..223,230..238,242..250,254..262, 266..271,278..280,302..310,317..322,329..331,344..346, 350..352,356..364,368..379) /gene="LOC106087661" /note="heterodimer interface [polypeptide binding]; other site" /db_xref="CDD:467043" misc_feature 470..631 /gene="LOC106087661" /note="TATA Binding Protein (TBP) Associated Factor 8; Region: TAF8; cd08049" /db_xref="CDD:176263" ORIGIN 1 tcgatatggc aacgttttca ttataataat tgtgattgtt aaaatattaa aagttaaatt 61 tgataaacaa atagtaaagt agttttactt taaaatggaa aaggcggatt gtacgcagcc 121 tactacgggc aatgccagac gtaaaattct gagcgtggca gtttcacaaa ttctaatgga 181 aaaaggattt gacagtgtag acaaagagtg cttggaaaca ctgactgaaa tgttacaaag 241 tttattggta gaggtaggtc aatcagctag aagctattgt gagctgtcgg gtcgcactat 301 acctgttgtg ggcgatgtag ttgttgcgct ggtaaatatg ggagtatcgc tgcagggtat 361 tgagaacttt gccaaacgag agggaaggca aataatatca atgcctccgc agcagcaaca 421 acagaaacaa ttgaatcttt tacaagcagg aactaaatct caccatcccc cacatattct 481 gccctatttg ccactttttc ctgacccaca tgcttatgtc aggacaccga cgcacaaaca 541 accagttacc gaatatgaag ctatacgaga aaaggcagca acacaaaaac gtgatataga 601 aaaagcgctg acaaaatttt tggccaaaac atcagagact catagccttt tcgatacaga 661 ggataatatg tttccattaa ttgcatgcaa acctgcattc ccaacttatt tggctgcttt 721 gaatccaacc gatcaagtat ttgactttga agagttggaa tatcattatt tagtagcaaa 781 cagaacagaa gattgcaagg acgaggacga taatgaaagt ggtaatgagg aagaaggcgc 841 tagcaatgat aatggtggag gtagtggcag cgctggaggg gacgaacccg aaaagaaatc 901 agaaaagact gaaaaagaaa cgaaacccga aaatgatatc aaacctaatt ccaccacaaa 961 taaagccatt ctggaaaatc ccaacattga ttccatttcg aatccttatt tacgagcggc 1021 tactttgccg aaacgagcca aaccagatcc tttagaccct ccatattcgg tttgtatata 1081 ttatgtattc cacattatat ctgacatagg aggccagtca taacgtggtc tgccatcgta 1141 tgatgctgaa aacctggcgc cgttcactaa tgctgacatt tttgggatct tcagccatat 1201 tataattctc taacaagggg gttgtcctgt ggcactgaac tacaaaaaaa cgtttatcat 1261 tgatttaaat tttaattcag acagcactga ttgatatgag aaaagtattt ctgctgttcc 1321 ataagggaat gtttggtcag atttgcatag gttgaggagt at