Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans transcription initiation factor


LOCUS       XM_013252785            1362 bp    mRNA    linear   INV 02-SEP-2023
            TFIID subunit 8 (LOC106087661), transcript variant X1, mRNA.
ACCESSION   XM_013252785
VERSION     XM_013252785.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252785.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1362
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1362
                     /gene="LOC106087661"
                     /note="transcription initiation factor TFIID subunit 8;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 7 Proteins"
                     /db_xref="GeneID:106087661"
     CDS             95..1123
                     /gene="LOC106087661"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit 8
                     isoform X1"
                     /protein_id="XP_013108239.1"
                     /db_xref="GeneID:106087661"
                     /translation="MEKADCTQPTTGNARRKILSVAVSQILMEKGFDSVDKECLETLT
                     EMLQSLLVEVGQSARSYCELSGRTIPVVGDVVVALVNMGVSLQGIENFAKREGRQIIS
                     MPPQQQQQKQLNLLQAGTKSHHPPHILPYLPLFPDPHAYVRTPTHKQPVTEYEAIREK
                     AATQKRDIEKALTKFLAKTSETHSLFDTEDNMFPLIACKPAFPTYLAALNPTDQVFDF
                     EELEYHYLVANRTEDCKDEDDNESGNEEEGASNDNGGGSGSAGGDEPEKKSEKTEKET
                     KPENDIKPNSTTNKAILENPNIDSISNPYLRAATLPKRAKPDPLDPPYSVCIYYVFHI
                     ISDIGGQS"
     misc_feature    134..379
                     /gene="LOC106087661"
                     /note="histone-fold domain found in transcription
                     initiation factor TFIID subunit 8 (TAF8) and similar
                     proteins; Region: HFD_TAF8; cd22918"
                     /db_xref="CDD:467043"
     misc_feature    order(134..136,164..166,188..199,269..271,275..277,
                     281..286,293..295,305..307,335..337)
                     /gene="LOC106087661"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467043"
     misc_feature    order(137..139,146..151,158..163,167..175,182..193,
                     200..202,206..211,218..223,230..238,242..250,254..262,
                     266..271,278..280,302..310,317..322,329..331,344..346,
                     350..352,356..364,368..379)
                     /gene="LOC106087661"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467043"
     misc_feature    470..631
                     /gene="LOC106087661"
                     /note="TATA Binding Protein (TBP) Associated Factor 8;
                     Region: TAF8; cd08049"
                     /db_xref="CDD:176263"
ORIGIN      
        1 tcgatatggc aacgttttca ttataataat tgtgattgtt aaaatattaa aagttaaatt
       61 tgataaacaa atagtaaagt agttttactt taaaatggaa aaggcggatt gtacgcagcc
      121 tactacgggc aatgccagac gtaaaattct gagcgtggca gtttcacaaa ttctaatgga
      181 aaaaggattt gacagtgtag acaaagagtg cttggaaaca ctgactgaaa tgttacaaag
      241 tttattggta gaggtaggtc aatcagctag aagctattgt gagctgtcgg gtcgcactat
      301 acctgttgtg ggcgatgtag ttgttgcgct ggtaaatatg ggagtatcgc tgcagggtat
      361 tgagaacttt gccaaacgag agggaaggca aataatatca atgcctccgc agcagcaaca
      421 acagaaacaa ttgaatcttt tacaagcagg aactaaatct caccatcccc cacatattct
      481 gccctatttg ccactttttc ctgacccaca tgcttatgtc aggacaccga cgcacaaaca
      541 accagttacc gaatatgaag ctatacgaga aaaggcagca acacaaaaac gtgatataga
      601 aaaagcgctg acaaaatttt tggccaaaac atcagagact catagccttt tcgatacaga
      661 ggataatatg tttccattaa ttgcatgcaa acctgcattc ccaacttatt tggctgcttt
      721 gaatccaacc gatcaagtat ttgactttga agagttggaa tatcattatt tagtagcaaa
      781 cagaacagaa gattgcaagg acgaggacga taatgaaagt ggtaatgagg aagaaggcgc
      841 tagcaatgat aatggtggag gtagtggcag cgctggaggg gacgaacccg aaaagaaatc
      901 agaaaagact gaaaaagaaa cgaaacccga aaatgatatc aaacctaatt ccaccacaaa
      961 taaagccatt ctggaaaatc ccaacattga ttccatttcg aatccttatt tacgagcggc
     1021 tactttgccg aaacgagcca aaccagatcc tttagaccct ccatattcgg tttgtatata
     1081 ttatgtattc cacattatat ctgacatagg aggccagtca taacgtggtc tgccatcgta
     1141 tgatgctgaa aacctggcgc cgttcactaa tgctgacatt tttgggatct tcagccatat
     1201 tataattctc taacaagggg gttgtcctgt ggcactgaac tacaaaaaaa cgtttatcat
     1261 tgatttaaat tttaattcag acagcactga ttgatatgag aaaagtattt ctgctgttcc
     1321 ataagggaat gtttggtcag atttgcatag gttgaggagt at