PREDICTED: Stomoxys calcitrans DNA excision repair protein ERCC-1

LOCUS       XM_013252757             960 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087642), mRNA.
ACCESSION   XM_013252757
VERSION     XM_013252757.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252757.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..960
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..960
                     /gene="LOC106087642"
                     /note="DNA excision repair protein ERCC-1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 6 Proteins"
                     /db_xref="GeneID:106087642"
     CDS             60..887
                     /gene="LOC106087642"
                     /codon_start=1
                     /product="DNA excision repair protein ERCC-1"
                     /protein_id="XP_013108211.1"
                     /db_xref="GeneID:106087642"
                     /translation="MDDYDDSFDMALATMEIPTAPKVPRMEPSSNQMRSTATKPQTKA
                     TQQSVSQGETKPIEENPAGTTVTTGAKTPANPHCILVHPKQRGNPILKSIQNCPLEFR
                     DDIIPDYVVGRTTCILYLSLKYHTLNPDYICQRLKELGKMYELRVLLVQVDTPEPQGA
                     IKSLTRISLLADLTLMLAWNAEEAGKMIETYKLFEKRPPDWIMERVDSNPHQKLCAAL
                     TNIKPVNKTDAVTLLQNFGNLENLINASEDRLSQVIGLGPRKAKKLYKTLQEPFLAK"
     misc_feature    288..674
                     /gene="LOC106087642"
                     /note="Central domain of ERCC1; Region: ERCC1_C-like;
                     cd22325"
                     /db_xref="CDD:411729"
     misc_feature    order(342..350,492..494,531..533,543..545,552..554,
                     561..566,573..590,594..596,606..608,615..620,624..632,
                     636..644,648..653,657..662)
                     /gene="LOC106087642"
                     /note="XPF interaction interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:411729"
     misc_feature    <705..875
                     /gene="LOC106087642"
                     /note="ERCC4-type crossover junction endonuclease
                     [Replication, recombination and repair]; Region: MUS81;
                     COG1948"
                     /db_xref="CDD:441551"
     polyA_site      960
                     /gene="LOC106087642"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaacaattac tttttgcagt agattccaag tttttcgatt gtgtttttag tattaaaaca
       61 tggacgatta cgatgattct tttgatatgg ctttagccac aatggaaata ccaacagcac
      121 caaaagtacc tcgtatggag ccttcaagta atcaaatgag atcaacagca acaaagcccc
      181 aaacgaaagc aacacaacag tctgtctcac aaggtgaaac aaaaccaatt gaagagaatc
      241 cagcgggcac aactgtcacc actggggcaa aaactccagc gaatccacat tgcattctgg
      301 ttcatcccaa acaaagagga aatcctatct taaagtctat acaaaattgc cccctcgaat
      361 ttcgggatga tatcataccc gactatgttg tgggacgtac cacatgcatt ttatatcttt
      421 ccctgaagta tcatacatta aatcccgatt atatatgtca acgattaaaa gagttgggta
      481 aaatgtatga gttgcgggta ctgctagtgc aagtggacac cccagaacca caaggggcaa
      541 tcaaaagtct gacacgcatc agcctattgg cagatctaac gctgatgttg gcctggaatg
      601 ctgaggaagc gggtaaaatg atagaaacct ataaattgtt tgaaaagagg ccgcccgact
      661 ggattatgga aagagtcgac tcaaatccac accaaaagct ttgcgccgcc ttaaccaaca
      721 tcaagccagt aaacaaaact gatgctgtga cacttttaca aaattttggc aacttggaga
      781 atttgataaa cgctagtgaa gatcgtttgt ctcaagtaat tggtctggga ccccgcaaag
      841 ccaagaagtt atacaaaact ctgcaagaac cttttctggc gaaatgaaag taaatgcaag
      901 aggaggtata tataagttgt tttcctattt attacaaaaa tataatgaac aaaaatctca