Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013252755 1138 bp mRNA linear INV 02-SEP-2023 protein assembly protein Ciao1 (LOC106087641), mRNA. ACCESSION XM_013252755 VERSION XM_013252755.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013252755.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1138 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1138 /gene="LOC106087641" /note="probable cytosolic iron-sulfur protein assembly protein Ciao1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106087641" CDS 60..1070 /gene="LOC106087641" /codon_start=1 /product="probable cytosolic iron-sulfur protein assembly protein Ciao1" /protein_id="XP_013108209.2" /db_xref="GeneID:106087641" /translation="MGKLQCEQTLQGHKGRIWCVSWHPKANAFASCGEDKTIRIWSMS GNNWTTKTILSDGHKRTIRDVAWSKCGQYLASASFDATTAIWSKTSGEFECNATLEGH ENEVKSCSWSNSGSLLATCSRDKSVWIWEVTGDDEFECAAVLNAHTQDVKRVVWHPTK EVLASCSYDNTIKMFAENALDNDWECTATLAGHSSTVWAIDFDAPGDRLVSVSDDCSM KVWRGYAPGNQEGIATPDNETAWKCICTVSGEHSRTIYDVAWCKLSGLIATACGDDAI RVFKEDEETSTKNEPVFVLATSQDKAHMQDVNKVTWNPVQQHQLLSCSDDGTIKIWKY SE" polyA_site 1138 /gene="LOC106087641" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agcatttgca aacgtaattg acaatataaa agaaaaacaa gcatcacaaa ttcataaaaa 61 tgggtaaatt gcaatgtgaa cagactctgc agggtcataa aggccgtatt tggtgtgttt 121 cttggcatcc caaggcaaat gcctttgctt catgtggcga agataagaca attcgcatat 181 ggtctatgtc cggtaataat tggacaacta aaaccatatt atccgatggt cataaaagaa 241 ccatacgaga tgtggcatgg tcaaaatgtg gacaatattt ggcctcggca agttttgatg 301 ccaccacagc tatatggtca aaaacatcag gtgaatttga atgcaatgcc actttggagg 361 gtcatgagaa cgaagtgaaa agttgcagtt ggtccaattc tggatctctg ttggcaactt 421 gttcgcgtga caagtcagtg tggatttggg aggttaccgg cgatgatgaa ttcgaatgtg 481 ctgccgtttt aaatgctcac acccaggatg taaaacgtgt tgtttggcat ccaacgaaag 541 aggtgctggc ctcatgttcc tatgacaaca ccatcaaaat gtttgctgaa aatgctttag 601 ataacgactg ggaatgtact gctactttgg caggccattc cagcactgta tgggccattg 661 attttgatgc acccggcgat aggttggttt ctgttagcga tgattgttcc atgaaagttt 721 ggcgtggtta tgcgcctgga aaccaagagg gtattgctac accagataat gaaacagcct 781 ggaagtgtat ttgcacagta agtggagaac attcacgcac aatttatgat gtggcctggt 841 gcaagttgag cggtcttatt gccacagcct gcggcgatga tgccatacga gttttcaaag 901 aagacgaaga gacttccacc aaaaatgaac cagtatttgt tctagctaca tcgcaggata 961 aagcccatat gcaggatgtt aataaggtga cctggaatcc agtgcaacag catcaacttt 1021 tatcttgtag tgatgatggt accattaaaa tatggaaata ttccgaataa aaaaacagca 1081 agaccatatg tgagattttt gttcattata tttttgtaat aaataggaaa acaactta