Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013252656 1308 bp mRNA linear INV 02-SEP-2023 ACCESSION XM_013252656 VERSION XM_013252656.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013252656.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1308 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1308 /gene="LOC106087569" /note="protein YIPF1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106087569" CDS 154..1185 /gene="LOC106087569" /codon_start=1 /product="protein YIPF1" /protein_id="XP_013108110.1" /db_xref="GeneID:106087569" /translation="MQSDDLLQFKDYTNTPSTSSPPAQINVNSPTHSTGSGSGGAGRQ RGDPLSDLIYDMSNSAQILSGGMSSSGGGGGGKNTGLPEPATATPSKTSFLTIEYYQR FFDVDTLVVLERIANSMIPKRAPSNYLKSSIGQNPDLYGPFWITTTLIFCIAISGNIA NYLQHQSETYQWHYNFHLVSYAATCIFIYANFLPGALWALFKYSLKPLEEGLETENAD YTPSLLSLMCVYGYSLAIYIPVSILWVIQLSILQWLLVITAALLSGSVLIAVLTPALR NSKYSLFLIIGILAAHFLLAAGFMLYFFHVPSSGTVGAHQTTMEAIKQPVKEVLEVTK AVVGNITNK" misc_feature 520..1053 /gene="LOC106087569" /note="Yip1 domain; Region: Yip1; pfam04893" /db_xref="CDD:461468" polyA_site 1308 /gene="LOC106087569" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cacaccaaat ccaatgacag cacacagctg actgaaaact aatcgacgtg ttaagccaat 61 ggaaaaaata aaatataatt aaaatttata ataataaaac acttgaaata agtagttaaa 121 agaaaaggca aaggactgaa ataacacaac atcatgcagt cagatgactt attgcagttt 181 aaggattaca ccaatacccc tagcaccagc agtcctccag cacaaataaa tgtcaattca 241 ccaacgcatt caacgggctc cggttctggt ggagctgggc ggcagcgtgg tgatcccctt 301 tccgatttaa tctatgacat gagcaattca gcgcaaattc tttccggtgg catgtcgtca 361 agtggtggag gtggcggtgg caaaaacact ggcttaccag agcctgccac ggcaacgccc 421 agtaaaactt cattcctgac cattgaatat tatcaaagat tctttgatgt tgataccttg 481 gtagtactgg aacgtattgc caattctatg atacccaaaa gggctcccag taattattta 541 aaatcgtcaa ttggacagaa tccggatttg tatggaccat tttggataac aacgactttg 601 atcttctgca ttgccattag cggcaatatt gccaattatc ttcagcatca aagtgaaact 661 taccagtggc attataactt ccatttggtc tcctatgcag ccacttgtat atttatctat 721 gcaaacttct tgccaggagc tttatgggcc ctcttcaaat acagtttgaa gcccttggaa 781 gagggtcttg aaacggaaaa tgctgattat actccatctt tattaagtct aatgtgcgtt 841 tatggatact cactggccat atacattcca gtatctattc tatgggttat tcagctttct 901 atactccaat ggcttctggt cattacagcc gccttattgt ccggctctgt attgatagct 961 gtactcactc cagctttgag aaattccaaa tattctttat ttttaattat tggcatatta 1021 gctgctcatt tcctgttagc tgccggtttt atgctatatt tcttccatgt acccagtagt 1081 ggtacagtcg gtgcccatca gaccaccatg gaggccataa aacaaccagt caaagaagta 1141 ctagaagtaa ccaaagctgt tgttggcaac ataaccaaca aataaaatgt gaggtgtttg 1201 ttcttctagg tttaaacaac ttctagtttt aagtattata tcagtagacg gcagaaaact 1261 aagaaaaata aatcaaataa aaaaatggaa aaatgtccca aacgataa