Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013252655 831 bp mRNA linear INV 02-SEP-2023 (LOC106087567), mRNA. ACCESSION XM_013252655 VERSION XM_013252655.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013252655.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..831 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..831 /gene="LOC106087567" /note="fibrinogen-like protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106087567" CDS 17..793 /gene="LOC106087567" /codon_start=1 /product="fibrinogen-like protein 1" /protein_id="XP_013108109.2" /db_xref="GeneID:106087567" /translation="MNIFKNFLIFAFIYFNSIESANIPTDESNSLVKVESLKLKLQQL ELDVRKQLVAGKLQWQLQTFQKWYQDAEKCSRDISYIFDDWTIIQRRINANENFHRNW TDYSNGFGDKQGSYFLGLEEIHQLTNSQPQELLVLLGDDEGKVAYAKYENVVIGSEKE KYELKELGEYSGDAGDSLCYHVGKQFSTFDQDNNDEMQRCAKVWVGGWWFGECFDSNL NGSNMKHKSGSISNEGIVWKHWHGMNYSLEFAQMMIRSKV" ORIGIN 1 ttatcgcatt cacatcatga atattttcaa aaattttctg atttttgcct tcatttattt 61 caattctatt gaaagtgcca acattccaac tgatgaatcg aattccttgg tcaaggtgga 121 gtcgttaaag ctcaaacttc aacagctgga gttggatgtc agaaaacaac tcgttgctgg 181 aaaattgcaa tggcaattgc agacatttca aaagtggtat caggatgctg agaaatgctc 241 tcgtgatatt tcctacatat ttgatgactg gacaattata cagagacgca ttaatgccaa 301 tgaaaatttc catagaaatt ggacggatta tagcaatggc tttggtgaca aacaaggaag 361 ctattttttg ggcttagagg aaattcacca gctgacaaac tcgcaacctc aagagttatt 421 ggtgcttttg ggcgatgatg aaggaaaagt ggcctatgcc aaatatgaaa atgttgtaat 481 aggaagtgag aaggagaaat atgagcttaa ggaattgggt gaatatagcg gagatgctgg 541 cgattcactg tgctatcatg taggtaagca attttctacc ttcgatcagg ataacaatga 601 tgaaatgcaa cgttgtgcta aagtctgggt aggaggttgg tggttcggtg aatgttttga 661 tagcaatctg aatggtagta acatgaaaca taaatcgggc tctatctcca atgaaggcat 721 agtttggaaa cactggcatg gcatgaacta ttctttggaa ttcgctcaaa tgatgataag 781 gtctaaggta tgaaaacatg aattcaaaaa cattgccttg gattgattaa a