Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans fibrinogen-like protein 1


LOCUS       XM_013252655             831 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087567), mRNA.
ACCESSION   XM_013252655
VERSION     XM_013252655.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252655.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..831
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..831
                     /gene="LOC106087567"
                     /note="fibrinogen-like protein 1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106087567"
     CDS             17..793
                     /gene="LOC106087567"
                     /codon_start=1
                     /product="fibrinogen-like protein 1"
                     /protein_id="XP_013108109.2"
                     /db_xref="GeneID:106087567"
                     /translation="MNIFKNFLIFAFIYFNSIESANIPTDESNSLVKVESLKLKLQQL
                     ELDVRKQLVAGKLQWQLQTFQKWYQDAEKCSRDISYIFDDWTIIQRRINANENFHRNW
                     TDYSNGFGDKQGSYFLGLEEIHQLTNSQPQELLVLLGDDEGKVAYAKYENVVIGSEKE
                     KYELKELGEYSGDAGDSLCYHVGKQFSTFDQDNNDEMQRCAKVWVGGWWFGECFDSNL
                     NGSNMKHKSGSISNEGIVWKHWHGMNYSLEFAQMMIRSKV"
ORIGIN      
        1 ttatcgcatt cacatcatga atattttcaa aaattttctg atttttgcct tcatttattt
       61 caattctatt gaaagtgcca acattccaac tgatgaatcg aattccttgg tcaaggtgga
      121 gtcgttaaag ctcaaacttc aacagctgga gttggatgtc agaaaacaac tcgttgctgg
      181 aaaattgcaa tggcaattgc agacatttca aaagtggtat caggatgctg agaaatgctc
      241 tcgtgatatt tcctacatat ttgatgactg gacaattata cagagacgca ttaatgccaa
      301 tgaaaatttc catagaaatt ggacggatta tagcaatggc tttggtgaca aacaaggaag
      361 ctattttttg ggcttagagg aaattcacca gctgacaaac tcgcaacctc aagagttatt
      421 ggtgcttttg ggcgatgatg aaggaaaagt ggcctatgcc aaatatgaaa atgttgtaat
      481 aggaagtgag aaggagaaat atgagcttaa ggaattgggt gaatatagcg gagatgctgg
      541 cgattcactg tgctatcatg taggtaagca attttctacc ttcgatcagg ataacaatga
      601 tgaaatgcaa cgttgtgcta aagtctgggt aggaggttgg tggttcggtg aatgttttga
      661 tagcaatctg aatggtagta acatgaaaca taaatcgggc tctatctcca atgaaggcat
      721 agtttggaaa cactggcatg gcatgaacta ttctttggaa ttcgctcaaa tgatgataag
      781 gtctaaggta tgaaaacatg aattcaaaaa cattgccttg gattgattaa a