Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106087563


LOCUS       XM_013252648             404 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087563), mRNA.
ACCESSION   XM_013252648
VERSION     XM_013252648.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252648.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..404
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..404
                     /gene="LOC106087563"
                     /note="uncharacterized LOC106087563; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:106087563"
     CDS             83..307
                     /gene="LOC106087563"
                     /codon_start=1
                     /product="uncharacterized protein LOC106087563"
                     /protein_id="XP_013108102.1"
                     /db_xref="GeneID:106087563"
                     /translation="MQKKRISTSSLLDKLHRGAVYTCLGITLYGTFLLGMRGWRYYTV
                     VRPERQQADLKMLEEGAPTQNNDTAKELKC"
     misc_feature    89..241
                     /gene="LOC106087563"
                     /note="Cytochrome oxidase c assembly; Region: COX14;
                     pfam14880"
                     /db_xref="CDD:434280"
     polyA_site      404
                     /gene="LOC106087563"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aacagctgtt cgattgataa actctactaa taggttataa aacaccccag aattcggcag
       61 catttattaa actcctcaaa aaatgcaaaa gaaacgtatt agcacctcaa gtctgcttga
      121 taaattgcat cgcggtgccg tctacacctg cttaggtatc acactctatg gtaccttctt
      181 gttgggtatg aggggatggc gttactacac tgtggttcgt ccagaaaggc agcaggcgga
      241 tctcaagatg ttggaagagg gagctccaac acagaacaac gatacagcaa aggaactaaa
      301 atgttgaatc taaataattt atttgttggc tgttgctttt taagttcata atgatactaa
      361 taaataatga ttactttaat ataaagtatt ataaattaaa ctaa