Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013252648 404 bp mRNA linear INV 02-SEP-2023 (LOC106087563), mRNA. ACCESSION XM_013252648 VERSION XM_013252648.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013252648.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..404 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..404 /gene="LOC106087563" /note="uncharacterized LOC106087563; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106087563" CDS 83..307 /gene="LOC106087563" /codon_start=1 /product="uncharacterized protein LOC106087563" /protein_id="XP_013108102.1" /db_xref="GeneID:106087563" /translation="MQKKRISTSSLLDKLHRGAVYTCLGITLYGTFLLGMRGWRYYTV VRPERQQADLKMLEEGAPTQNNDTAKELKC" misc_feature 89..241 /gene="LOC106087563" /note="Cytochrome oxidase c assembly; Region: COX14; pfam14880" /db_xref="CDD:434280" polyA_site 404 /gene="LOC106087563" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aacagctgtt cgattgataa actctactaa taggttataa aacaccccag aattcggcag 61 catttattaa actcctcaaa aaatgcaaaa gaaacgtatt agcacctcaa gtctgcttga 121 taaattgcat cgcggtgccg tctacacctg cttaggtatc acactctatg gtaccttctt 181 gttgggtatg aggggatggc gttactacac tgtggttcgt ccagaaaggc agcaggcgga 241 tctcaagatg ttggaagagg gagctccaac acagaacaac gatacagcaa aggaactaaa 301 atgttgaatc taaataattt atttgttggc tgttgctttt taagttcata atgatactaa 361 taaataatga ttactttaat ataaagtatt ataaattaaa ctaa