Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013252598 974 bp mRNA linear INV 02-SEP-2023 (LOC106087540), mRNA. ACCESSION XM_013252598 VERSION XM_013252598.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013252598.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..974 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..974 /gene="LOC106087540" /note="achaete-scute complex protein T4; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106087540" CDS 27..974 /gene="LOC106087540" /codon_start=1 /product="achaete-scute complex protein T4" /protein_id="XP_013108052.2" /db_xref="GeneID:106087540" /translation="MSSVSCNQSNAQHLFPTTIVSSGKMLKYPHIQPHPMAEDGKSRK VNRAQPYNAEQSQHSVLRRNARERNRVKQVNNSFARLRQHIPQTIIADLTKGGGRGPQ KKISKVDTLRIAVEYIRRLEDLLEDLNGGSISLPQQFELQNNSSNCDTASNSSFSSSG SSTTASVYNSSPTPVYYTQSTSPLPSLMDANLQSGHLNPYGNSTTLLSPVSLNSYSPQ HNTVYDNNNTSSSNNNITNGSQSPTSSFNSSLSYETANFEGQPLPDLSSTQINAAAAH FETNIQLKFEPYDNFNLDEEDCTPDDEEILDYISLWQEQ" ORIGIN 1 taactttaaa ttgttgaaaa aataaaatgt caagtgttag ttgtaatcaa tcgaacgctc 61 aacatttatt tcccaccaca attgtgtctt cgggcaaaat gcttaaatat ccccacattc 121 aaccccatcc catggcggag gatggcaaaa gtcgcaaagt gaaccgtgct caaccctaca 181 atgctgaaca atcacagcat tcggtgctta ggcgcaatgc ccgcgaacga aatcgtgtga 241 aacaagtgaa caatagtttt gcccgcctcc gacagcacat acctcagacg attatagcag 301 atttgaccaa gggtggaggt cgtggccccc aaaagaagat aagcaaggtg gatactctac 361 gcattgcggt ggagtatata cgccgattgg aagacttact ggaggatttg aatggcggca 421 gcataagtct gccacagcaa tttgagttgc aaaacaacag ctcaaattgt gatacggcca 481 gcaatagttc cttcagttcc agtgggtcct cgaccacagc ttcagtgtac aatagctcac 541 ccacaccggt gtattatacg caatccacca gccctttgcc ttcattgatg gatgccaatc 601 tgcaatcggg tcatttgaat ccctatggca acagcacaac tttgctctct ccagtatccc 661 taaactcgta ttcgcctcaa cataatacag tgtatgacaa taacaatacc agtagcagta 721 acaacaacat caccaatggc agtcaatcac ccacctcatc tttcaactcc agtctgtcct 781 atgaaacagc caactttgag ggtcaaccct tgcccgactt atcctcaaca caaatcaatg 841 ctgcagctgc acatttcgag accaacattc aattgaaatt tgaaccctac gacaatttca 901 atttggatga ggaggattgc acccccgacg atgaggagat cttagattat atatccttgt 961 ggcaggaaca gtag