Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans peptidyl-prolyl cis-trans isomerase


LOCUS       XM_013252446            1298 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087413), transcript variant X3, mRNA.
ACCESSION   XM_013252446
VERSION     XM_013252446.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252446.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1298
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1298
                     /gene="LOC106087413"
                     /note="peptidyl-prolyl cis-trans isomerase; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 150 Proteins"
                     /db_xref="GeneID:106087413"
     CDS             108..740
                     /gene="LOC106087413"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase isoform X3"
                     /protein_id="XP_013107900.1"
                     /db_xref="GeneID:106087413"
                     /translation="MSFLGATLARCCRQMSVGAARPIIFNSATTSQLQFGFSVRSFAS
                     NKMGLPRVFFDMTADGQPLGRITMELRSDVVPKTAENFRALCTGEKGIGYKGSCFHRV
                     IPNFMCQGGDFTNHNGTGGKSIYGNKFADENFTLKHTGPGILSMANAGPNTNGSQFFI
                     CTVKTAWLDNKHVVFGQVVDGMEVVKNIESYGSQSGKTTKKIVVSDCGAL"
     misc_feature    255..731
                     /gene="LOC106087413"
                     /note="Cyclophilin A, B and H-like cyclophilin-type
                     peptidylprolyl cis- trans isomerase (PPIase) domain. This
                     family represents the archetypal cystolic cyclophilin
                     similar to human cyclophilins A, B and H. PPIase is an
                     enzyme which accelerates protein folding...; Region:
                     cyclophilin_ABH_like; cd01926"
                     /db_xref="CDD:238907"
     misc_feature    order(405..410,423..425,576..578,582..584,606..608)
                     /gene="LOC106087413"
                     /note="active site"
                     /db_xref="CDD:238907"
     polyA_site      1298
                     /gene="LOC106087413"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tagtgcattt ttaattgatc gcacgtgcat tttcccaaaa ttcattggcc gaactatatt
       61 gaatagttat tttcaagcgg ttaaagtata ttatccactc aagaatcatg tctttcctag
      121 gggcaactct ggcacgctgc tgccgtcaaa tgtcagttgg cgcagcaaga cctatcattt
      181 tcaacagcgc tacaacgagt cagttgcagt ttggattcag tgttcgcagt ttcgctagca
      241 ataaaatggg tttacctcgt gtcttctttg atatgaccgc tgatggtcag ccattgggtc
      301 gcattactat ggagctccgt agcgatgttg ttcccaagac cgctgagaac ttccgtgctc
      361 tctgcactgg cgaaaagggt atcggttaca agggctcctg tttccatcgt gtcattccca
      421 acttcatgtg tcaaggaggt gatttcacaa atcacaatgg cactggcggt aaatccatct
      481 atggcaacaa attcgccgat gagaacttca ccttgaagca taccggcccc ggcatcttgt
      541 ccatggccaa tgctggcccc aataccaatg gctctcagtt ctttatctgt accgtaaaga
      601 ccgcttggtt ggataacaaa cacgtggtct tcggtcaggt ggttgatggc atggaagttg
      661 taaaaaatat cgaatcctat ggttctcaat cgggcaagac gaccaagaag atcgttgtca
      721 gcgattgtgg tgctttgtaa acaaacattc tccccctctc caaccaacca cacaaaggcg
      781 cgtctatgca cgccgccaca caacatcaat aaagcaaaaa agcaacacaa aaccaacaaa
      841 ctatattaaa tatattttaa taaacgtatt tttaagaaag aaaaaatgaa agagagagag
      901 ctttagtcag cagttctgcc gtctctcgct cacaccggca aaataaacaa aatcagaggg
      961 agcatttaat aattccattt aatagtaatg aaaaacaaaa ccattcaatt gcttatgtgg
     1021 tgctgcatgc atgcagtagt ggttcattcg catcgcgcac atgtatcgca gatggatata
     1081 tggaggatat agagtctaac gctgccgccg tcgccatctt tcacaccaca tcattccttc
     1141 cctttctaac acaacaacta ccaatttaaa atatgcttaa agtgtaatta atgtaattgt
     1201 tctcttcttt aaattttcca aaatgaaatt cttataatta ttattttttt tttattttat
     1261 aaaaataaaa cattctactt tttcctgtcc aaaagaaa