Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013252446 1298 bp mRNA linear INV 02-SEP-2023 (LOC106087413), transcript variant X3, mRNA. ACCESSION XM_013252446 VERSION XM_013252446.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013252446.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1298 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1298 /gene="LOC106087413" /note="peptidyl-prolyl cis-trans isomerase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 150 Proteins" /db_xref="GeneID:106087413" CDS 108..740 /gene="LOC106087413" /codon_start=1 /product="peptidyl-prolyl cis-trans isomerase isoform X3" /protein_id="XP_013107900.1" /db_xref="GeneID:106087413" /translation="MSFLGATLARCCRQMSVGAARPIIFNSATTSQLQFGFSVRSFAS NKMGLPRVFFDMTADGQPLGRITMELRSDVVPKTAENFRALCTGEKGIGYKGSCFHRV IPNFMCQGGDFTNHNGTGGKSIYGNKFADENFTLKHTGPGILSMANAGPNTNGSQFFI CTVKTAWLDNKHVVFGQVVDGMEVVKNIESYGSQSGKTTKKIVVSDCGAL" misc_feature 255..731 /gene="LOC106087413" /note="Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain. This family represents the archetypal cystolic cyclophilin similar to human cyclophilins A, B and H. PPIase is an enzyme which accelerates protein folding...; Region: cyclophilin_ABH_like; cd01926" /db_xref="CDD:238907" misc_feature order(405..410,423..425,576..578,582..584,606..608) /gene="LOC106087413" /note="active site" /db_xref="CDD:238907" polyA_site 1298 /gene="LOC106087413" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tagtgcattt ttaattgatc gcacgtgcat tttcccaaaa ttcattggcc gaactatatt 61 gaatagttat tttcaagcgg ttaaagtata ttatccactc aagaatcatg tctttcctag 121 gggcaactct ggcacgctgc tgccgtcaaa tgtcagttgg cgcagcaaga cctatcattt 181 tcaacagcgc tacaacgagt cagttgcagt ttggattcag tgttcgcagt ttcgctagca 241 ataaaatggg tttacctcgt gtcttctttg atatgaccgc tgatggtcag ccattgggtc 301 gcattactat ggagctccgt agcgatgttg ttcccaagac cgctgagaac ttccgtgctc 361 tctgcactgg cgaaaagggt atcggttaca agggctcctg tttccatcgt gtcattccca 421 acttcatgtg tcaaggaggt gatttcacaa atcacaatgg cactggcggt aaatccatct 481 atggcaacaa attcgccgat gagaacttca ccttgaagca taccggcccc ggcatcttgt 541 ccatggccaa tgctggcccc aataccaatg gctctcagtt ctttatctgt accgtaaaga 601 ccgcttggtt ggataacaaa cacgtggtct tcggtcaggt ggttgatggc atggaagttg 661 taaaaaatat cgaatcctat ggttctcaat cgggcaagac gaccaagaag atcgttgtca 721 gcgattgtgg tgctttgtaa acaaacattc tccccctctc caaccaacca cacaaaggcg 781 cgtctatgca cgccgccaca caacatcaat aaagcaaaaa agcaacacaa aaccaacaaa 841 ctatattaaa tatattttaa taaacgtatt tttaagaaag aaaaaatgaa agagagagag 901 ctttagtcag cagttctgcc gtctctcgct cacaccggca aaataaacaa aatcagaggg 961 agcatttaat aattccattt aatagtaatg aaaaacaaaa ccattcaatt gcttatgtgg 1021 tgctgcatgc atgcagtagt ggttcattcg catcgcgcac atgtatcgca gatggatata 1081 tggaggatat agagtctaac gctgccgccg tcgccatctt tcacaccaca tcattccttc 1141 cctttctaac acaacaacta ccaatttaaa atatgcttaa agtgtaatta atgtaattgt 1201 tctcttcttt aaattttcca aaatgaaatt cttataatta ttattttttt tttattttat 1261 aaaaataaaa cattctactt tttcctgtcc aaaagaaa