Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013252445 921 bp mRNA linear INV 02-SEP-2023 (LOC106087413), transcript variant X2, mRNA. ACCESSION XM_013252445 VERSION XM_013252445.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013252445.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..921 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..921 /gene="LOC106087413" /note="peptidyl-prolyl cis-trans isomerase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 141 Proteins" /db_xref="GeneID:106087413" CDS 151..786 /gene="LOC106087413" /codon_start=1 /product="peptidyl-prolyl cis-trans isomerase isoform X2" /protein_id="XP_013107899.1" /db_xref="GeneID:106087413" /translation="MSFLGATLARCCRQMSVGAARPIIFNSATTSQLQFGFSVRSFAS NKMGLPRVFFDMTADGQPLGRITMELRKDVVPKTAENFRQLCTGKKGFGFKGCSFHRV IPNFMCQGGDFTKNDGTGGKSIYGTTFKDENFKLKHTGPGILSMANAGPNTNGSQFFI CTVKTPWLDGQHVVFGQVIQGMDVVKKMESYGCPEGRPLKEIIIADCGEIK" misc_feature 298..774 /gene="LOC106087413" /note="Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain. This family represents the archetypal cystolic cyclophilin similar to human cyclophilins A, B and H. PPIase is an enzyme which accelerates protein folding...; Region: cyclophilin_ABH_like; cd01926" /db_xref="CDD:238907" misc_feature order(448..453,466..468,619..621,625..627,649..651) /gene="LOC106087413" /note="active site" /db_xref="CDD:238907" polyA_site 921 /gene="LOC106087413" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aacaccctta attacgcaat tttcaaaata acaaataccg ctatagtgca tttttaattg 61 atcgcacgtg cattttccca aaattcattg gccgaactat attgaatagt tattttcaag 121 cggttaaagt atattatcca ctcaagaatc atgtctttcc taggggcaac tctggcacgc 181 tgctgccgtc aaatgtcagt tggcgcagca agacctatca ttttcaacag cgctacaacg 241 agtcagttgc agtttggatt cagtgttcgc agtttcgcta gcaataaaat gggtttacct 301 cgtgtcttct ttgatatgac cgctgatggt cagccattgg gtcgcattac tatggagtta 361 cgcaaagatg tggtacccaa aacggcagag aattttcgcc aactgtgcac tggcaaaaag 421 ggctttggct tcaagggctg ctctttccat cgtgtcatac ccaacttcat gtgtcaagga 481 ggagatttta ccaaaaatga tggtactggg ggtaaatcga tttatggcac cacctttaag 541 gatgagaact ttaaactcaa gcacaccggt cccggcatat tatccatggc taatgcgggc 601 cccaacacca atggttcgca gttctttatt tgcacagtga aaacgccctg gctagatggt 661 cagcatgtgg tatttggtca agtgattcaa ggcatggatg ttgttaagaa aatggaatcc 721 tatggttgtc cggagggtcg tcccttaaag gagatcataa tagccgattg tggtgaaatt 781 aaataataat tcaactattg tagaacacag tgtgtgggcc aagttgcttg ttagatattt 841 ttgttgttgt tattgcaaaa aagtattata tagagttata gtaaataaaa ataaatggat 901 ttttataatc cccaaaatgc a