Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans peptidyl-prolyl cis-trans isomerase


LOCUS       XM_013252445             921 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087413), transcript variant X2, mRNA.
ACCESSION   XM_013252445
VERSION     XM_013252445.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252445.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..921
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..921
                     /gene="LOC106087413"
                     /note="peptidyl-prolyl cis-trans isomerase; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 141 Proteins"
                     /db_xref="GeneID:106087413"
     CDS             151..786
                     /gene="LOC106087413"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase isoform X2"
                     /protein_id="XP_013107899.1"
                     /db_xref="GeneID:106087413"
                     /translation="MSFLGATLARCCRQMSVGAARPIIFNSATTSQLQFGFSVRSFAS
                     NKMGLPRVFFDMTADGQPLGRITMELRKDVVPKTAENFRQLCTGKKGFGFKGCSFHRV
                     IPNFMCQGGDFTKNDGTGGKSIYGTTFKDENFKLKHTGPGILSMANAGPNTNGSQFFI
                     CTVKTPWLDGQHVVFGQVIQGMDVVKKMESYGCPEGRPLKEIIIADCGEIK"
     misc_feature    298..774
                     /gene="LOC106087413"
                     /note="Cyclophilin A, B and H-like cyclophilin-type
                     peptidylprolyl cis- trans isomerase (PPIase) domain. This
                     family represents the archetypal cystolic cyclophilin
                     similar to human cyclophilins A, B and H. PPIase is an
                     enzyme which accelerates protein folding...; Region:
                     cyclophilin_ABH_like; cd01926"
                     /db_xref="CDD:238907"
     misc_feature    order(448..453,466..468,619..621,625..627,649..651)
                     /gene="LOC106087413"
                     /note="active site"
                     /db_xref="CDD:238907"
     polyA_site      921
                     /gene="LOC106087413"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aacaccctta attacgcaat tttcaaaata acaaataccg ctatagtgca tttttaattg
       61 atcgcacgtg cattttccca aaattcattg gccgaactat attgaatagt tattttcaag
      121 cggttaaagt atattatcca ctcaagaatc atgtctttcc taggggcaac tctggcacgc
      181 tgctgccgtc aaatgtcagt tggcgcagca agacctatca ttttcaacag cgctacaacg
      241 agtcagttgc agtttggatt cagtgttcgc agtttcgcta gcaataaaat gggtttacct
      301 cgtgtcttct ttgatatgac cgctgatggt cagccattgg gtcgcattac tatggagtta
      361 cgcaaagatg tggtacccaa aacggcagag aattttcgcc aactgtgcac tggcaaaaag
      421 ggctttggct tcaagggctg ctctttccat cgtgtcatac ccaacttcat gtgtcaagga
      481 ggagatttta ccaaaaatga tggtactggg ggtaaatcga tttatggcac cacctttaag
      541 gatgagaact ttaaactcaa gcacaccggt cccggcatat tatccatggc taatgcgggc
      601 cccaacacca atggttcgca gttctttatt tgcacagtga aaacgccctg gctagatggt
      661 cagcatgtgg tatttggtca agtgattcaa ggcatggatg ttgttaagaa aatggaatcc
      721 tatggttgtc cggagggtcg tcccttaaag gagatcataa tagccgattg tggtgaaatt
      781 aaataataat tcaactattg tagaacacag tgtgtgggcc aagttgcttg ttagatattt
      841 ttgttgttgt tattgcaaaa aagtattata tagagttata gtaaataaaa ataaatggat
      901 ttttataatc cccaaaatgc a