PREDICTED: Stomoxys calcitrans peptidyl-prolyl cis-trans isomerase

LOCUS       XM_013252444             917 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087413), transcript variant X1, mRNA.
ACCESSION   XM_013252444
VERSION     XM_013252444.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252444.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..917
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..917
                     /gene="LOC106087413"
                     /note="peptidyl-prolyl cis-trans isomerase; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 148 Proteins"
                     /db_xref="GeneID:106087413"
     CDS             134..769
                     /gene="LOC106087413"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase isoform X1"
                     /protein_id="XP_013107898.1"
                     /db_xref="GeneID:106087413"
                     /translation="MSFLGATLARCCRQMSVGAARPIIFNSATTSQLQFGFSVRSFAS
                     NKMGLPRVFFDMTADGQPLGRITMELRSDVVPKTADNFRALCTGEKGFGYKGSSFHRV
                     IPRFMCQGGDFTNHNGTGGKSIYGETFRDENFKLKHTGPGILSMANAGPHTNGSQFFI
                     CTEKTEWLDGKHVVFGSIVDGMDVVKRIESFGSDSGKTKKKIVVQDCGELK"
     misc_feature    281..757
                     /gene="LOC106087413"
                     /note="Cyclophilin A, B and H-like cyclophilin-type
                     peptidylprolyl cis- trans isomerase (PPIase) domain. This
                     family represents the archetypal cystolic cyclophilin
                     similar to human cyclophilins A, B and H. PPIase is an
                     enzyme which accelerates protein folding...; Region:
                     cyclophilin_ABH_like; cd01926"
                     /db_xref="CDD:238907"
     misc_feature    order(431..436,449..451,602..604,608..610,632..634)
                     /gene="LOC106087413"
                     /note="active site"
                     /db_xref="CDD:238907"
     polyA_site      917
                     /gene="LOC106087413"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aattttcaaa ataacaaata ccgctatagt gcatttttaa ttgatcgcac gtgcattttc
       61 ccaaaattca ttggccgaac tatattgaat agttattttc aagcggttaa agtatattat
      121 ccactcaaga atcatgtctt tcctaggggc aactctggca cgctgctgcc gtcaaatgtc
      181 agttggcgca gcaagaccta tcattttcaa cagcgctaca acgagtcagt tgcagtttgg
      241 attcagtgtt cgcagtttcg ctagcaataa aatgggttta cctcgtgtct tctttgatat
      301 gaccgctgat ggtcagccat tgggtcgcat tactatggag ttacgctccg atgttgtacc
      361 caagaccgct gacaactttc gtgctctctg cacgggagag aaaggattcg gttataaggg
      421 ctcctcgttt catcgtgtaa tccccagatt tatgtgtcaa ggtggtgatt tcacaaatca
      481 caatggcact ggcggtaaat ccatttatgg tgagaccttc cgcgatgaaa acttcaagct
      541 caagcacacc ggtcctggca ttttgtccat ggccaatgcc ggtccccaca ccaatggttc
      601 gcagtttttc atttgcaccg agaaaactga gtggttggat ggtaaacatg tggtctttgg
      661 cagcatcgtt gatggcatgg atgtggtcaa gagaatcgag agtttcggca gtgattcggg
      721 caagaccaaa aagaagattg ttgtacagga ttgtggcgaa ttaaaataag tgtgtggtgt
      781 tgtgatgttt gatgtaattt agaatgaatg tattttccaa aaaagaaaaa aacgaattga
      841 attatcatta gtgaagagaa gagttatcaa taaacatcat ttcatgaaga attatcatta
      901 aacaaaatcg ctaaaaa