Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013252435 448 bp mRNA linear INV 02-SEP-2023 (LOC106087409), mRNA. ACCESSION XM_013252435 VERSION XM_013252435.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013252435.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..448 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..448 /gene="LOC106087409" /note="uncharacterized LOC106087409; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106087409" CDS 4..417 /gene="LOC106087409" /codon_start=1 /product="uncharacterized protein LOC106087409" /protein_id="XP_013107889.2" /db_xref="GeneID:106087409" /translation="MSNGWERIRLRVETKESLKSGNMDDTRTISCHILDTAVGKAAAG VPLVLYRQLPNDQWQEMGQATTNEDGRVSQLLGYADFQSGIYKLRFNIQPYFEAKKTP SFYPYIEIVVKCERGQHYHIPLLLSPFGYTTYRGT" polyA_site 448 /gene="LOC106087409" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaaatgagca acggttggga gcgtatacgt ctacgagtcg agaccaagga gagccttaaa 61 tctggaaaca tggatgatac acgaacaata tcctgccata tattagacac tgctgtgggt 121 aaagctgctg ccggtgtccc cttagtgcta tatcgtcaat tgcccaatga ccagtggcaa 181 gagatgggcc aggccaccac caacgaagat ggccgtgtta gtcaattgct gggctatgcc 241 gactttcaaa gtggaattta taaactgcga tttaatatac agccctattt tgaggccaag 301 aaaaccccaa gtttttatcc ctacattgag attgtggtaa aatgcgaaag aggacaacat 361 tatcatattc cattgttatt gtccccattt ggttatacca catatagggg aacttaataa 421 agtgtattgt tgtgaaaagt taaaagaa