Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106087409


LOCUS       XM_013252435             448 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087409), mRNA.
ACCESSION   XM_013252435
VERSION     XM_013252435.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252435.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..448
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..448
                     /gene="LOC106087409"
                     /note="uncharacterized LOC106087409; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:106087409"
     CDS             4..417
                     /gene="LOC106087409"
                     /codon_start=1
                     /product="uncharacterized protein LOC106087409"
                     /protein_id="XP_013107889.2"
                     /db_xref="GeneID:106087409"
                     /translation="MSNGWERIRLRVETKESLKSGNMDDTRTISCHILDTAVGKAAAG
                     VPLVLYRQLPNDQWQEMGQATTNEDGRVSQLLGYADFQSGIYKLRFNIQPYFEAKKTP
                     SFYPYIEIVVKCERGQHYHIPLLLSPFGYTTYRGT"
     polyA_site      448
                     /gene="LOC106087409"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaaatgagca acggttggga gcgtatacgt ctacgagtcg agaccaagga gagccttaaa
       61 tctggaaaca tggatgatac acgaacaata tcctgccata tattagacac tgctgtgggt
      121 aaagctgctg ccggtgtccc cttagtgcta tatcgtcaat tgcccaatga ccagtggcaa
      181 gagatgggcc aggccaccac caacgaagat ggccgtgtta gtcaattgct gggctatgcc
      241 gactttcaaa gtggaattta taaactgcga tttaatatac agccctattt tgaggccaag
      301 aaaaccccaa gtttttatcc ctacattgag attgtggtaa aatgcgaaag aggacaacat
      361 tatcatattc cattgttatt gtccccattt ggttatacca catatagggg aacttaataa
      421 agtgtattgt tgtgaaaagt taaaagaa