Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013252432 527 bp mRNA linear INV 02-SEP-2023 28a-like (LOC106087407), mRNA. ACCESSION XM_013252432 VERSION XM_013252432.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013252432.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..527 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..527 /gene="LOC106087407" /note="general odorant-binding protein 28a-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106087407" CDS 18..479 /gene="LOC106087407" /codon_start=1 /product="general odorant-binding protein 28a-like" /protein_id="XP_013107886.2" /db_xref="GeneID:106087407" /translation="MKIIAILLFCVTAVLAAEQLKPNEWCSGAYLREAIRKCGAEYGA TQADADDYIQHRPAANDKMKCYRACLFNECRAFNMDGSFVANAPQTTAFLASRINPSH WEPAEKAAKICIAKTPYGTDRCETVEQFSLCLTEKSPVKLSYEDNFIEKNR" ORIGIN 1 caaaattttt gtttaaaatg aaaatcattg ccatcttatt attttgtgtc acagcggttt 61 tggctgcaga gcaactgaaa ccgaatgaat ggtgcagtgg tgcctattta agggaagcca 121 tacggaaatg tggtgcagaa tatggagcca cacaagctga tgccgatgat tatatacaac 181 atcgtcctgc agccaatgat aaaatgaaat gctatcgtgc ttgtcttttc aatgaatgta 241 gagcgtttaa tatggatggc agctttgtgg ccaatgctcc tcaaactaca gcatttttgg 301 catctcgtat taacccctca cactgggaac ctgctgaaaa agcagccaaa atttgtattg 361 ccaaaactcc atacggaaca gacagatgtg aaaccgttga gcaattttca ctttgtctga 421 cagaaaaatc tccagtaaaa ctatcttatg aagacaattt catagaaaag aatcgctgaa 481 cgttgaaatg aggaagcctt acttagtaaa tagaacatcg aacaccg