Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans general odorant-binding protein


LOCUS       XM_013252432             527 bp    mRNA    linear   INV 02-SEP-2023
            28a-like (LOC106087407), mRNA.
ACCESSION   XM_013252432
VERSION     XM_013252432.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252432.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..527
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..527
                     /gene="LOC106087407"
                     /note="general odorant-binding protein 28a-like; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:106087407"
     CDS             18..479
                     /gene="LOC106087407"
                     /codon_start=1
                     /product="general odorant-binding protein 28a-like"
                     /protein_id="XP_013107886.2"
                     /db_xref="GeneID:106087407"
                     /translation="MKIIAILLFCVTAVLAAEQLKPNEWCSGAYLREAIRKCGAEYGA
                     TQADADDYIQHRPAANDKMKCYRACLFNECRAFNMDGSFVANAPQTTAFLASRINPSH
                     WEPAEKAAKICIAKTPYGTDRCETVEQFSLCLTEKSPVKLSYEDNFIEKNR"
ORIGIN      
        1 caaaattttt gtttaaaatg aaaatcattg ccatcttatt attttgtgtc acagcggttt
       61 tggctgcaga gcaactgaaa ccgaatgaat ggtgcagtgg tgcctattta agggaagcca
      121 tacggaaatg tggtgcagaa tatggagcca cacaagctga tgccgatgat tatatacaac
      181 atcgtcctgc agccaatgat aaaatgaaat gctatcgtgc ttgtcttttc aatgaatgta
      241 gagcgtttaa tatggatggc agctttgtgg ccaatgctcc tcaaactaca gcatttttgg
      301 catctcgtat taacccctca cactgggaac ctgctgaaaa agcagccaaa atttgtattg
      361 ccaaaactcc atacggaaca gacagatgtg aaaccgttga gcaattttca ctttgtctga
      421 cagaaaaatc tccagtaaaa ctatcttatg aagacaattt catagaaaag aatcgctgaa
      481 cgttgaaatg aggaagcctt acttagtaaa tagaacatcg aacaccg