Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106087406


LOCUS       XM_013252431             620 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087406), mRNA.
ACCESSION   XM_013252431
VERSION     XM_013252431.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252431.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..620
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..620
                     /gene="LOC106087406"
                     /note="uncharacterized LOC106087406; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106087406"
     CDS             44..535
                     /gene="LOC106087406"
                     /codon_start=1
                     /product="uncharacterized protein LOC106087406"
                     /protein_id="XP_013107885.2"
                     /db_xref="GeneID:106087406"
                     /translation="MPSTLFLILGSAIVLSHCQMSSAQGQGGWGGNGANSWSSSSSSG
                     QPGQPGRSEVSYGYGGVDANGVPYGGYGGNGGYNINVSDEQGRTHTYSGGPGAPGGYP
                     GAPGGAPGQPGYPSTFSYASTNNQGRGYGNSSSSSFASASSSAWNTFYVIALFTLYAM
                     IKF"
     polyA_site      620
                     /gene="LOC106087406"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caactttcgg cgttagtaca ttaacaactc tgaatgagtt aacatgccat cgacgctgtt
       61 cttgatattg ggaagcgcta ttgtattaag tcactgccaa atgagttcag cacaaggtca
      121 aggaggttgg ggtggcaatg gagccaattc gtggtcttca tccagttcaa gtggccaacc
      181 aggacaaccg ggtcgcagtg aggttagcta tggctatggt ggtgtagatg ccaatggtgt
      241 accctatggc ggttatggtg gcaatggtgg ctataacatc aatgtaagcg atgaacaagg
      301 acgcactcac acctacagcg gaggtcctgg agctccaggt ggctatcctg gagctcccgg
      361 tggagctccg ggacaacctg gttaccccag cacatttagt tatgccagta cgaataatca
      421 aggacgtggt tatggcaatt cttcatcctc ttcatttgct tcggcttcct cgtccgcttg
      481 gaataccttt tatgtgatag ccttattcac tttgtatgct atgattaaat tttaagtttt
      541 tcttttaaca gattttattg ttatgatcta tgaagctcaa ttgttagtgt tttaagtgat
      601 aattaaaagt gaaaatgaaa