Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013252431 620 bp mRNA linear INV 02-SEP-2023 (LOC106087406), mRNA. ACCESSION XM_013252431 VERSION XM_013252431.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013252431.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..620 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..620 /gene="LOC106087406" /note="uncharacterized LOC106087406; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106087406" CDS 44..535 /gene="LOC106087406" /codon_start=1 /product="uncharacterized protein LOC106087406" /protein_id="XP_013107885.2" /db_xref="GeneID:106087406" /translation="MPSTLFLILGSAIVLSHCQMSSAQGQGGWGGNGANSWSSSSSSG QPGQPGRSEVSYGYGGVDANGVPYGGYGGNGGYNINVSDEQGRTHTYSGGPGAPGGYP GAPGGAPGQPGYPSTFSYASTNNQGRGYGNSSSSSFASASSSAWNTFYVIALFTLYAM IKF" polyA_site 620 /gene="LOC106087406" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 caactttcgg cgttagtaca ttaacaactc tgaatgagtt aacatgccat cgacgctgtt 61 cttgatattg ggaagcgcta ttgtattaag tcactgccaa atgagttcag cacaaggtca 121 aggaggttgg ggtggcaatg gagccaattc gtggtcttca tccagttcaa gtggccaacc 181 aggacaaccg ggtcgcagtg aggttagcta tggctatggt ggtgtagatg ccaatggtgt 241 accctatggc ggttatggtg gcaatggtgg ctataacatc aatgtaagcg atgaacaagg 301 acgcactcac acctacagcg gaggtcctgg agctccaggt ggctatcctg gagctcccgg 361 tggagctccg ggacaacctg gttaccccag cacatttagt tatgccagta cgaataatca 421 aggacgtggt tatggcaatt cttcatcctc ttcatttgct tcggcttcct cgtccgcttg 481 gaataccttt tatgtgatag ccttattcac tttgtatgct atgattaaat tttaagtttt 541 tcttttaaca gattttattg ttatgatcta tgaagctcaa ttgttagtgt tttaagtgat 601 aattaaaagt gaaaatgaaa