PREDICTED: Stomoxys calcitrans peptidyl-prolyl cis-trans isomerase

LOCUS       XM_013252420             511 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087395), partial mRNA.
ACCESSION   XM_013252420
VERSION     XM_013252420.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252420.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..511
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            <1..511
                     /gene="LOC106087395"
                     /note="peptidyl-prolyl cis-trans isomerase; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 150 Proteins"
                     /db_xref="GeneID:106087395"
     CDS             <1..465
                     /gene="LOC106087395"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="XP_013107874.1"
                     /db_xref="GeneID:106087395"
                     /translation="SPKCTFHLLLFLQLRVDVVPKTTENFRALCTGEKGFGYKGSTFH
                     RVIPNFMCQGGDFTAHNGTGGKSIYGNKFDDENFVLKHTEAGTLSMANSGPNTNGSQF
                     FITTVKTAWLDNRHVVFGRVVEGLDIVKKIEAMGSQSGKTSKNIVISDSGQL"
     misc_feature    34..456
                     /gene="LOC106087395"
                     /note="cyclophilin-type peptidylprolyl cis- trans
                     isomerases. This family contains eukaryotic, bacterial and
                     archeal proteins which exhibit a peptidylprolyl cis- trans
                     isomerases activity (PPIase, Rotamase) and in addition
                     bind the immunosuppressive drug...; Region: cyclophilin;
                     cl00197"
                     /db_xref="CDD:469651"
     misc_feature    order(133..135,139..141,148..153,157..159,271..276,
                     301..303,307..309,331..336,346..348)
                     /gene="LOC106087395"
                     /note="active site"
                     /db_xref="CDD:238194"
     polyA_site      511
                     /gene="LOC106087395"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tccccaaaat gcacatttca tttacttttg tttttgcagc tgcgagtcga tgttgtgccc
       61 aagaccacgg agaattttcg cgctttgtgc accggtgaaa aaggatttgg ctacaaaggc
      121 tccacctttc atcgtgtcat accgaatttt atgtgccaag gtggagactt tactgcgcat
      181 aatggcaccg gcggcaaatc catttatggc aataaattcg atgatgagaa tttcgttttg
      241 aaacacaccg aggcgggtac tttgtccatg gccaattcgg gacccaatac caatggttca
      301 cagtttttta taaccaccgt taagacagct tggctggata atcgtcatgt ggtctttgga
      361 cgcgttgtcg aaggcttgga tattgtaaag aaaatcgaag ccatgggcag tcaatcgggt
      421 aaaacatcga aaaatattgt catcagcgac agtggacagt tgtaaggagt ggcaataata
      481 aaaaacaaac attttttttt gaaaaaatat a