PREDICTED: Stomoxys calcitrans proteasome subunit alpha type-7-1

LOCUS       XM_013252394             978 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087370), mRNA.
ACCESSION   XM_013252394
VERSION     XM_013252394.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252394.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..978
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..978
                     /gene="LOC106087370"
                     /note="proteasome subunit alpha type-7-1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 24 Proteins"
                     /db_xref="GeneID:106087370"
     CDS             102..848
                     /gene="LOC106087370"
                     /codon_start=1
                     /product="proteasome subunit alpha type-7-1"
                     /protein_id="XP_013107848.1"
                     /db_xref="GeneID:106087370"
                     /translation="MSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVL
                     GVEKKSVAKLQEERTVRKICLLDHHVVMAFAGLTADARILINRAQVECQSHKLNVEDP
                     VTLEYITRYIAQLKQKYTQSNGRRPFGISCLIGGFDYDGTPHLYQTEPSGIYYEWKAN
                     ATGRSAKTVREFLEKQYKDEEVATENGAVKLAIKALLEVAQSGQKNLEIAVMEKNKPL
                     KMLDAQTIEQYVAVIEKEKEEEAEKKKQKK"
     misc_feature    111..737
                     /gene="LOC106087370"
                     /note="The 20S proteasome, multisubunit proteolytic
                     complex, is the central enzyme of nonlysosomal protein
                     degradation in both the cytosol and nucleus. It is
                     composed of 28 subunits arranged as four homoheptameric
                     rings that stack on top of one another forming...; Region:
                     proteasome_alpha_type_7; cd03755"
                     /db_xref="CDD:239724"
     misc_feature    order(117..128,132..137,141..146,156..158,165..167,
                     174..179,186..188,210..212,255..257,261..266,333..341,
                     345..350,441..443,450..452,459..464,471..485,537..539,
                     552..557,561..563,567..572,576..578)
                     /gene="LOC106087370"
                     /note="alpha subunit interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239724"
     misc_feature    order(192..194,240..242,246..248,285..287,591..593)
                     /gene="LOC106087370"
                     /note="active site"
                     /db_xref="CDD:239724"
     polyA_site      978
                     /gene="LOC106087370"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctctaatcat caacactgaa gctgacaaac actttttgat ttctgctaat catcggtgtt
       61 tttatttagc gccagcgata ttttattttt ctattgctag gatgtcacgc tacgatcgcg
      121 ctgtaaccat tttctcgcct gatggtcatt tgctgcaagt agaatatgct caggaggctg
      181 tacgcaaagg ttcaacagct gttggagttc gtggagcaaa ttgcgtggtt ttgggcgtag
      241 agaagaaatc tgtagcaaaa ttgcaggaag aacgtactgt acgcaaaata tgtcttttag
      301 accaccatgt tgttatggct tttgctggtc tcactgccga cgctcgtatt cttattaacc
      361 gtgcccaagt agaatgtcaa agtcataaac ttaatgttga agatccagtt acattagagt
      421 acatcacaag atacatcgcc caattaaagc aaaagtacac gcaaagtaat ggtcgtcgtc
      481 catttggtat ttcatgtctc attggtggtt ttgactatga tggtacccct cacctatacc
      541 aaacggaacc gtctggaatc tactatgagt ggaaagcaaa tgcaactgga cgttcagcta
      601 aaactgtacg agagtttttg gaaaaacaat ataaagatga agaagttgcc acagaaaatg
      661 gcgctgttaa actggcgata aaagctttac tagaggttgc acagtccgga caaaagaatc
      721 tggaaattgc tgtgatggaa aagaataaac ctttaaaaat gcttgacgcc caaacaattg
      781 aacaatatgt agccgtcatt gaaaaagaaa aggaagaaga ggctgaaaag aagaaacaaa
      841 aaaaataaat gcaatcgaaa gagatgtcta catttacaaa ctgtgtatca catggtttta
      901 attatttaaa tatcctcatt tggtttaaat atttagcttt tctgtataaa tggaaataaa
      961 acaaaatatc gtattcaa