Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013252061 516 bp mRNA linear INV 02-SEP-2023 (LOC106087133), transcript variant X1, mRNA. ACCESSION XM_013252061 VERSION XM_013252061.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013252061.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..516 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..516 /gene="LOC106087133" /note="uncharacterized LOC106087133; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106087133" CDS 29..334 /gene="LOC106087133" /codon_start=1 /product="uncharacterized protein LOC106087133" /protein_id="XP_013107515.2" /db_xref="GeneID:106087133" /translation="MLAGLTDDFKPLVMAVENSKEKLTVDMVKNVLLQDAKFDKAFEK ESASQSKGVKKAVNGDEHTHITMDCNNDRWLYTRSCTPKVEISFAFLRSCNHSSQLH" ORIGIN 1 tcaagatgac aaattgatcg catctttaat gttagctggt ttaaccgatg actttaagcc 61 gcttgtcatg gctgtggaga attctaagga aaaattgacg gtagatatgg tgaagaatgt 121 tctacttcaa gacgcaaaat ttgataaagc ttttgagaaa gaatcagcat cacagtcaaa 181 aggtgtcaag aaagcagtta acggggacga acacacacat attacgatgg attgtaacaa 241 tgaccggtgg ttatatactc gctcttgcac cccaaaggtg gaaatttcgt ttgcttttct 301 tcgcagttgc aatcattcgt cgcagttgca ttaaaaaaac tgcaggactc aagcagaaaa 361 agaagcactg gcctccgtcc acagaaattg aaggtcagtg catatatagg tataccttga 421 atgatccgta caacgaaaca catcgaaata ctactttacc acaaaactgg ttacacatta 481 aatactcaca acgaacaatt taacatcaaa tatagg