Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106087133


LOCUS       XM_013252061             516 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087133), transcript variant X1, mRNA.
ACCESSION   XM_013252061
VERSION     XM_013252061.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252061.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..516
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..516
                     /gene="LOC106087133"
                     /note="uncharacterized LOC106087133; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106087133"
     CDS             29..334
                     /gene="LOC106087133"
                     /codon_start=1
                     /product="uncharacterized protein LOC106087133"
                     /protein_id="XP_013107515.2"
                     /db_xref="GeneID:106087133"
                     /translation="MLAGLTDDFKPLVMAVENSKEKLTVDMVKNVLLQDAKFDKAFEK
                     ESASQSKGVKKAVNGDEHTHITMDCNNDRWLYTRSCTPKVEISFAFLRSCNHSSQLH"
ORIGIN      
        1 tcaagatgac aaattgatcg catctttaat gttagctggt ttaaccgatg actttaagcc
       61 gcttgtcatg gctgtggaga attctaagga aaaattgacg gtagatatgg tgaagaatgt
      121 tctacttcaa gacgcaaaat ttgataaagc ttttgagaaa gaatcagcat cacagtcaaa
      181 aggtgtcaag aaagcagtta acggggacga acacacacat attacgatgg attgtaacaa
      241 tgaccggtgg ttatatactc gctcttgcac cccaaaggtg gaaatttcgt ttgcttttct
      301 tcgcagttgc aatcattcgt cgcagttgca ttaaaaaaac tgcaggactc aagcagaaaa
      361 agaagcactg gcctccgtcc acagaaattg aaggtcagtg catatatagg tataccttga
      421 atgatccgta caacgaaaca catcgaaata ctactttacc acaaaactgg ttacacatta
      481 aatactcaca acgaacaatt taacatcaaa tatagg