PREDICTED: Stomoxys calcitrans antigen 5 like allergen Cul n 1-like

LOCUS       XM_013252060             987 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087132), transcript variant X2, mRNA.
ACCESSION   XM_013252060
VERSION     XM_013252060.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..987
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..987
                     /gene="LOC106087132"
                     /note="antigen 5 like allergen Cul n 1-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 10 Proteins"
                     /db_xref="GeneID:106087132"
     CDS             112..882
                     /gene="LOC106087132"
                     /codon_start=1
                     /product="antigen 5 like allergen Cul n 1-like"
                     /protein_id="XP_013107514.1"
                     /db_xref="GeneID:106087132"
                     /translation="MNLLVHILSVLILIGIAIASEYCSSSLCSSGSHIACDHSGDFDS
                     SCPSDAAMVEIDSSLKDAIIKYHNEKRNLVAGGEAANHDAACRMATMEWDDKLAYLAT
                     LNVRQCKMAHDDCRNTDTFKYAGQNLAWRTFSSEPNYIELANTSMDMWYDEVEHSNMV
                     YINSYPENYDGPDIGHFTVMMNGPNNRLGCAAATYEADDPSKQTFLIACNYARTNVAG
                     LAVYESCSSAGSSCTTGENSEYPNLCSTSEEYDVNDLS"
     misc_feature    289..747
                     /gene="LOC106087132"
                     /note="Eukaryotic CAP (cysteine-rich secretory proteins,
                     antigen 5, and pathogenesis-related 1 proteins) domain
                     proteins; Region: CAP_euk; cd05380"
                     /db_xref="CDD:349399"
     polyA_site      987
                     /gene="LOC106087132"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcaaacacga agaaaaacgg ttgaaaatca atgttcgaag aaaatcaaga tattgctctc
       61 ggataatggc tgtggagaac attgctctcg gataatggct gtttagaaaa aatgaatctt
      121 ttggtccaca ttctaagtgt tttgattctc attggcatcg caattgctag tgaatattgt
      181 tcctcatcgt tatgcagcag tgggtcacat atagcctgtg atcacagtgg ggattttgat
      241 tcatcgtgtc cttcagatgc tgccatggtc gaaatcgatt catccttaaa agacgccatt
      301 atcaaatacc acaatgagaa acgaaatttg gtagccggag gagaagctgc taaccatgat
      361 gctgcttgtc gcatggctac catggaatgg gatgataaat tggcatactt ggctacactt
      421 aacgtacgtc agtgcaaaat ggctcatgac gattgtcgta atacggacac atttaagtac
      481 gccggtcaaa atttagcctg gaggacattc tcgagcgaac caaattacat tgaattggca
      541 aataccagca tggacatgtg gtacgatgaa gtggaacaca gtaatatggt ttacattaac
      601 tcttaccccg aaaactacga cggacctgat attggacact tcacagtaat gatgaatgga
      661 cccaacaatc gccttggttg cgctgctgcc acttacgaag ctgatgatcc ctcaaagcaa
      721 acttttttga ttgcttgtaa ttatgccaga accaacgtcg ctggattagc tgtttatgaa
      781 agttgcagtt cggcagggtc atcttgtacc acaggcgaaa attctgaata tcccaatttg
      841 tgttcaacat ctgaagaata tgacgtcaat gatttgtctt aaatagttat ataataattc
      901 ggtttttgtc cggtgtgctt cgctacactc taaaattgtg ttagaaaata aatatttctc
      961 aaagcattgt gaagcttgta cacagaa