Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans antigen 5 like allergen Cul n 1-like


LOCUS       XM_013252059            1040 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087132), transcript variant X1, mRNA.
ACCESSION   XM_013252059
VERSION     XM_013252059.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1040
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1040
                     /gene="LOC106087132"
                     /note="antigen 5 like allergen Cul n 1-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 10 Proteins"
                     /db_xref="GeneID:106087132"
     CDS             165..935
                     /gene="LOC106087132"
                     /codon_start=1
                     /product="antigen 5 like allergen Cul n 1-like"
                     /protein_id="XP_013107513.1"
                     /db_xref="GeneID:106087132"
                     /translation="MNLLVHILSVLILIGIAIASEYCSSSLCSSGSHIACDHSGDFDS
                     SCPSDAAMVEIDSSLKDAIIKYHNEKRNLVAGGEAANHDAACRMATMEWDDKLAYLAT
                     LNVRQCKMAHDDCRNTDTFKYAGQNLAWRTFSSEPNYIELANTSMDMWYDEVEHSNMV
                     YINSYPENYDGPDIGHFTVMMNGPNNRLGCAAATYEADDPSKQTFLIACNYARTNVAG
                     LAVYESCSSAGSSCTTGENSEYPNLCSTSEEYDVNDLS"
     misc_feature    342..800
                     /gene="LOC106087132"
                     /note="Eukaryotic CAP (cysteine-rich secretory proteins,
                     antigen 5, and pathogenesis-related 1 proteins) domain
                     proteins; Region: CAP_euk; cd05380"
                     /db_xref="CDD:349399"
     polyA_site      1040
                     /gene="LOC106087132"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caaacacgaa gagtaagcag aactgtggga aatgccaaaa aactgtagga atttttccat
       61 tcagataaaa cggttgaaaa tcaatgttcg aagaaaatca agatattgct ctcggataat
      121 ggctgtggag aacattgctc tcggataatg gctgtttaga aaaaatgaat cttttggtcc
      181 acattctaag tgttttgatt ctcattggca tcgcaattgc tagtgaatat tgttcctcat
      241 cgttatgcag cagtgggtca catatagcct gtgatcacag tggggatttt gattcatcgt
      301 gtccttcaga tgctgccatg gtcgaaatcg attcatcctt aaaagacgcc attatcaaat
      361 accacaatga gaaacgaaat ttggtagccg gaggagaagc tgctaaccat gatgctgctt
      421 gtcgcatggc taccatggaa tgggatgata aattggcata cttggctaca cttaacgtac
      481 gtcagtgcaa aatggctcat gacgattgtc gtaatacgga cacatttaag tacgccggtc
      541 aaaatttagc ctggaggaca ttctcgagcg aaccaaatta cattgaattg gcaaatacca
      601 gcatggacat gtggtacgat gaagtggaac acagtaatat ggtttacatt aactcttacc
      661 ccgaaaacta cgacggacct gatattggac acttcacagt aatgatgaat ggacccaaca
      721 atcgccttgg ttgcgctgct gccacttacg aagctgatga tccctcaaag caaacttttt
      781 tgattgcttg taattatgcc agaaccaacg tcgctggatt agctgtttat gaaagttgca
      841 gttcggcagg gtcatcttgt accacaggcg aaaattctga atatcccaat ttgtgttcaa
      901 catctgaaga atatgacgtc aatgatttgt cttaaatagt tatataataa ttcggttttt
      961 gtccggtgtg cttcgctaca ctctaaaatt gtgttagaaa ataaatattt ctcaaagcat
     1021 tgtgaagctt gtacacagaa