Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013252059 1040 bp mRNA linear INV 02-SEP-2023 (LOC106087132), transcript variant X1, mRNA. ACCESSION XM_013252059 VERSION XM_013252059.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1040 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1040 /gene="LOC106087132" /note="antigen 5 like allergen Cul n 1-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106087132" CDS 165..935 /gene="LOC106087132" /codon_start=1 /product="antigen 5 like allergen Cul n 1-like" /protein_id="XP_013107513.1" /db_xref="GeneID:106087132" /translation="MNLLVHILSVLILIGIAIASEYCSSSLCSSGSHIACDHSGDFDS SCPSDAAMVEIDSSLKDAIIKYHNEKRNLVAGGEAANHDAACRMATMEWDDKLAYLAT LNVRQCKMAHDDCRNTDTFKYAGQNLAWRTFSSEPNYIELANTSMDMWYDEVEHSNMV YINSYPENYDGPDIGHFTVMMNGPNNRLGCAAATYEADDPSKQTFLIACNYARTNVAG LAVYESCSSAGSSCTTGENSEYPNLCSTSEEYDVNDLS" misc_feature 342..800 /gene="LOC106087132" /note="Eukaryotic CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain proteins; Region: CAP_euk; cd05380" /db_xref="CDD:349399" polyA_site 1040 /gene="LOC106087132" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 caaacacgaa gagtaagcag aactgtggga aatgccaaaa aactgtagga atttttccat 61 tcagataaaa cggttgaaaa tcaatgttcg aagaaaatca agatattgct ctcggataat 121 ggctgtggag aacattgctc tcggataatg gctgtttaga aaaaatgaat cttttggtcc 181 acattctaag tgttttgatt ctcattggca tcgcaattgc tagtgaatat tgttcctcat 241 cgttatgcag cagtgggtca catatagcct gtgatcacag tggggatttt gattcatcgt 301 gtccttcaga tgctgccatg gtcgaaatcg attcatcctt aaaagacgcc attatcaaat 361 accacaatga gaaacgaaat ttggtagccg gaggagaagc tgctaaccat gatgctgctt 421 gtcgcatggc taccatggaa tgggatgata aattggcata cttggctaca cttaacgtac 481 gtcagtgcaa aatggctcat gacgattgtc gtaatacgga cacatttaag tacgccggtc 541 aaaatttagc ctggaggaca ttctcgagcg aaccaaatta cattgaattg gcaaatacca 601 gcatggacat gtggtacgat gaagtggaac acagtaatat ggtttacatt aactcttacc 661 ccgaaaacta cgacggacct gatattggac acttcacagt aatgatgaat ggacccaaca 721 atcgccttgg ttgcgctgct gccacttacg aagctgatga tccctcaaag caaacttttt 781 tgattgcttg taattatgcc agaaccaacg tcgctggatt agctgtttat gaaagttgca 841 gttcggcagg gtcatcttgt accacaggcg aaaattctga atatcccaat ttgtgttcaa 901 catctgaaga atatgacgtc aatgatttgt cttaaatagt tatataataa ttcggttttt 961 gtccggtgtg cttcgctaca ctctaaaatt gtgttagaaa ataaatattt ctcaaagcat 1021 tgtgaagctt gtacacagaa