Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013252021 503 bp mRNA linear INV 02-SEP-2023 (LOC106087103), mRNA. ACCESSION XM_013252021 VERSION XM_013252021.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013252021.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..503 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..503 /gene="LOC106087103" /note="uncharacterized LOC106087103; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106087103" CDS 16..393 /gene="LOC106087103" /codon_start=1 /product="uncharacterized protein LOC106087103" /protein_id="XP_013107475.2" /db_xref="GeneID:106087103" /translation="MEMENGGLILRWSKLTDHALEPVRARENAAGYDLSSAYDLMVPA RGSAMMRTDLQVQMPRGFCGHIFSRFSALNNGITVGQDVVVNADFRDNLEVMLFNHSE QDFEVKRGDCIVQLVIGAADAQI" polyA_site 503 /gene="LOC106087103" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 taagtaaagg tgggaatgga aatggaaaac ggcggactaa ttctgcgttg gagtaagcta 61 accgatcatg ccttggaacc agttcgtgcc agggagaatg cggccggata tgacttaagt 121 agtgcctatg atttgatggt tccagctcgt ggctctgcta tgatgaggac cgatctgcaa 181 gttcaaatgc ctagaggttt ttgtggacat attttttcac ggttttctgc tcttaataat 241 ggcattactg ttggtcagga tgtcgtcgta aatgctgatt tccgtgataa tcttgaagtt 301 atgctcttca atcactctga gcaagacttc gaagtgaaac gtggtgattg catcgttcag 361 ttagtgattg gtgctgctga tgcccaaata taaacccaat ttcttcttaa tacggtgtat 421 cttgtgttca gttgtgtgtt ttatgatttt taccatgcgt taatctgaat ttgtttttaa 481 ataaaaactt tatgtcaccc gtt