Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106087103


LOCUS       XM_013252021             503 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087103), mRNA.
ACCESSION   XM_013252021
VERSION     XM_013252021.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252021.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..503
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..503
                     /gene="LOC106087103"
                     /note="uncharacterized LOC106087103; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106087103"
     CDS             16..393
                     /gene="LOC106087103"
                     /codon_start=1
                     /product="uncharacterized protein LOC106087103"
                     /protein_id="XP_013107475.2"
                     /db_xref="GeneID:106087103"
                     /translation="MEMENGGLILRWSKLTDHALEPVRARENAAGYDLSSAYDLMVPA
                     RGSAMMRTDLQVQMPRGFCGHIFSRFSALNNGITVGQDVVVNADFRDNLEVMLFNHSE
                     QDFEVKRGDCIVQLVIGAADAQI"
     polyA_site      503
                     /gene="LOC106087103"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 taagtaaagg tgggaatgga aatggaaaac ggcggactaa ttctgcgttg gagtaagcta
       61 accgatcatg ccttggaacc agttcgtgcc agggagaatg cggccggata tgacttaagt
      121 agtgcctatg atttgatggt tccagctcgt ggctctgcta tgatgaggac cgatctgcaa
      181 gttcaaatgc ctagaggttt ttgtggacat attttttcac ggttttctgc tcttaataat
      241 ggcattactg ttggtcagga tgtcgtcgta aatgctgatt tccgtgataa tcttgaagtt
      301 atgctcttca atcactctga gcaagacttc gaagtgaaac gtggtgattg catcgttcag
      361 ttagtgattg gtgctgctga tgcccaaata taaacccaat ttcttcttaa tacggtgtat
      421 cttgtgttca gttgtgtgtt ttatgatttt taccatgcgt taatctgaat ttgtttttaa
      481 ataaaaactt tatgtcaccc gtt