Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013252015 542 bp mRNA linear INV 02-SEP-2023 (LOC106087099), mRNA. ACCESSION XM_013252015 VERSION XM_013252015.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013252015.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..542 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..542 /gene="LOC106087099" /note="uncharacterized LOC106087099; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106087099" CDS 182..484 /gene="LOC106087099" /codon_start=1 /product="uncharacterized protein LOC106087099" /protein_id="XP_013107469.2" /db_xref="GeneID:106087099" /translation="MPFKCCCSNSDGDSVSNKSWTPGVVNKSFDTVENKQPHAVTNQP RSSDSTPTNTMGRPSTASNDSETFSKIDLNLNIFEKDRFTDMSKTIHKSQMNLNDI" polyA_site 542 /gene="LOC106087099" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ggcacttgtg gtatttgtct ctgagagcct aacggcccat aaagaaaagc attatttcta 61 tagacagaaa aaaccattat tattaaccat atcaagaaca cattatagta tcgataatac 121 aacagagcaa gtgtatcata agtgatttga gcagtgcata gtgtttaaat cagaaactag 181 aatgcctttc aaatgttgtt gctcaaattc tgatggcgat tcggtttcaa acaagtcctg 241 gacaccgggt gtggtcaata aaagttttga tactgtcgaa aacaaacaac ctcatgctgt 301 aacaaatcaa cctcggtcca gtgattcgac accaacaaac accatgggcc gtccatcgac 361 agcaagcaat gatagcgaaa ccttttcgaa aatcgatttg aatttgaata tctttgagaa 421 agatcgtttt acggatatgt caaagaccat acataaaagt caaatgaatc taaatgatat 481 ataaattttg tattattttc tatatgtata agaataaact ttaacctgtg tatatttatt 541 aa