Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106087099


LOCUS       XM_013252015             542 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087099), mRNA.
ACCESSION   XM_013252015
VERSION     XM_013252015.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252015.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..542
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..542
                     /gene="LOC106087099"
                     /note="uncharacterized LOC106087099; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106087099"
     CDS             182..484
                     /gene="LOC106087099"
                     /codon_start=1
                     /product="uncharacterized protein LOC106087099"
                     /protein_id="XP_013107469.2"
                     /db_xref="GeneID:106087099"
                     /translation="MPFKCCCSNSDGDSVSNKSWTPGVVNKSFDTVENKQPHAVTNQP
                     RSSDSTPTNTMGRPSTASNDSETFSKIDLNLNIFEKDRFTDMSKTIHKSQMNLNDI"
     polyA_site      542
                     /gene="LOC106087099"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ggcacttgtg gtatttgtct ctgagagcct aacggcccat aaagaaaagc attatttcta
       61 tagacagaaa aaaccattat tattaaccat atcaagaaca cattatagta tcgataatac
      121 aacagagcaa gtgtatcata agtgatttga gcagtgcata gtgtttaaat cagaaactag
      181 aatgcctttc aaatgttgtt gctcaaattc tgatggcgat tcggtttcaa acaagtcctg
      241 gacaccgggt gtggtcaata aaagttttga tactgtcgaa aacaaacaac ctcatgctgt
      301 aacaaatcaa cctcggtcca gtgattcgac accaacaaac accatgggcc gtccatcgac
      361 agcaagcaat gatagcgaaa ccttttcgaa aatcgatttg aatttgaata tctttgagaa
      421 agatcgtttt acggatatgt caaagaccat acataaaagt caaatgaatc taaatgatat
      481 ataaattttg tattattttc tatatgtata agaataaact ttaacctgtg tatatttatt
      541 aa