Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013252001 840 bp mRNA linear INV 02-SEP-2023 ACCESSION XM_013252001 VERSION XM_013252001.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013252001.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..840 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..840 /gene="LOC106087093" /note="prisilkin-39; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106087093" CDS 76..711 /gene="LOC106087093" /codon_start=1 /product="prisilkin-39" /protein_id="XP_013107455.1" /db_xref="GeneID:106087093" /translation="MKCFAICIVIFCYLASSARAANDLVAAASENSVQSQDQLQGSAS SLSPLTEKHQEKRYVGGYGGYGGYGTGLDTLGGYGGYSGAASPYAGYGGYSGYGGYGG YGNYGGYGGYSGYGGYNSRLGIDGYAGYPGYNGYSGYPYSSYGSYNRAYPYGRGGYYG GYNSYPSSYYSGGYGNSIVGGGLGALGTAGYVPPVGGAGYQYGPGITGSVY" polyA_site 840 /gene="LOC106087093" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcttagtagt tttagagtta atagttaagt gctctaaacg gatttacgat aacgaaattt 61 tcatataaag ccaacatgaa gtgttttgcc atttgcattg tcatcttctg ctaccttgca 121 tcatcagcaa gggctgctaa tgatttggtt gcagcagctt cggagaactc tgtacaatcc 181 caggatcaac tgcaaggatc cgccagcagt ttgagtcctt tgactgagaa acatcaagag 241 aaacgttacg taggtggtta tggcggttat ggaggttatg gcaccggctt ggacacccta 301 ggcggttatg gcggttattc aggcgctgct tccccctatg ctggttatgg aggttatagc 361 ggctatggag gttatggagg ttatggcaac tatggaggtt atggtggata ttctggctat 421 ggaggttata attcaagatt gggcatagat ggctatgctg gctatcccgg ctacaatggc 481 tattccggtt atccatattc cagctacggc agctataatc gcgcatatcc ctatggccgt 541 ggtggttatt atggtggcta taacagttat ccttctagct actattcagg tggttatggc 601 aacagcattg ttggcggtgg tttgggagca cttggaactg ctggttatgt acctcctgtg 661 ggtggtgctg gctatcagta tggccccggc attaccggat ctgtgtacta atgtatttgt 721 gtgtgggagg aaaaagcagt ttgagctttt tcaaattttt tattttcaat tttagaacaa 781 attgtaaatt cgcttttttt acaaaaacaa ttattaaatt atgattttta tttggaataa