Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans prisilkin-39 (LOC106087093), mRNA.


LOCUS       XM_013252001             840 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_013252001
VERSION     XM_013252001.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013252001.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..840
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..840
                     /gene="LOC106087093"
                     /note="prisilkin-39; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:106087093"
     CDS             76..711
                     /gene="LOC106087093"
                     /codon_start=1
                     /product="prisilkin-39"
                     /protein_id="XP_013107455.1"
                     /db_xref="GeneID:106087093"
                     /translation="MKCFAICIVIFCYLASSARAANDLVAAASENSVQSQDQLQGSAS
                     SLSPLTEKHQEKRYVGGYGGYGGYGTGLDTLGGYGGYSGAASPYAGYGGYSGYGGYGG
                     YGNYGGYGGYSGYGGYNSRLGIDGYAGYPGYNGYSGYPYSSYGSYNRAYPYGRGGYYG
                     GYNSYPSSYYSGGYGNSIVGGGLGALGTAGYVPPVGGAGYQYGPGITGSVY"
     polyA_site      840
                     /gene="LOC106087093"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcttagtagt tttagagtta atagttaagt gctctaaacg gatttacgat aacgaaattt
       61 tcatataaag ccaacatgaa gtgttttgcc atttgcattg tcatcttctg ctaccttgca
      121 tcatcagcaa gggctgctaa tgatttggtt gcagcagctt cggagaactc tgtacaatcc
      181 caggatcaac tgcaaggatc cgccagcagt ttgagtcctt tgactgagaa acatcaagag
      241 aaacgttacg taggtggtta tggcggttat ggaggttatg gcaccggctt ggacacccta
      301 ggcggttatg gcggttattc aggcgctgct tccccctatg ctggttatgg aggttatagc
      361 ggctatggag gttatggagg ttatggcaac tatggaggtt atggtggata ttctggctat
      421 ggaggttata attcaagatt gggcatagat ggctatgctg gctatcccgg ctacaatggc
      481 tattccggtt atccatattc cagctacggc agctataatc gcgcatatcc ctatggccgt
      541 ggtggttatt atggtggcta taacagttat ccttctagct actattcagg tggttatggc
      601 aacagcattg ttggcggtgg tttgggagca cttggaactg ctggttatgt acctcctgtg
      661 ggtggtgctg gctatcagta tggccccggc attaccggat ctgtgtacta atgtatttgt
      721 gtgtgggagg aaaaagcagt ttgagctttt tcaaattttt tattttcaat tttagaacaa
      781 attgtaaatt cgcttttttt acaaaaacaa ttattaaatt atgattttta tttggaataa