Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013251998 353 bp mRNA linear INV 02-SEP-2023 (LOC106087091), mRNA. ACCESSION XM_013251998 VERSION XM_013251998.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013251998.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..353 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..353 /gene="LOC106087091" /note="V-type proton ATPase subunit e; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:106087091" CDS 94..351 /gene="LOC106087091" /codon_start=1 /product="V-type proton ATPase subunit e" /protein_id="XP_013107452.1" /db_xref="GeneID:106087091" /translation="MGASFFPILFFTAIWASVGIGLPMMTPKGPHQNLIRCTLMLTGA TCWLFWLCCYMAQMNPLIGPKLNQHAIFMIAREWGNTLKEG" misc_feature 112..288 /gene="LOC106087091" /note="ATP synthase subunit H; Region: ATP_synt_H; pfam05493" /db_xref="CDD:461663" polyA_site 353 /gene="LOC106087091" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtaaaagtcg acttcgactt aaattcctag tgtgtgtata ttaacaaaaa aaattggtga 61 ttgaataaaa ttgaaaaagc ttaaaaatac ataatgggag catcattttt tcctattctc 121 ttcttcaccg ccatctgggc cagcgtgggt attggtctgc caatgatgac acctaaagga 181 ccccatcaaa atctcatacg ttgcacttta atgttgactg gagcgacgtg ttggctattt 241 tggctatgct gttacatggc ccaaatgaat cctttaatag gacccaaact aaatcaacat 301 gccattttca tgattgccag agaatggggc aataccctga aggaaggcta aaa