Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans V-type proton ATPase subunit e


LOCUS       XM_013251998             353 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087091), mRNA.
ACCESSION   XM_013251998
VERSION     XM_013251998.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251998.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..353
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..353
                     /gene="LOC106087091"
                     /note="V-type proton ATPase subunit e; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 13 Proteins"
                     /db_xref="GeneID:106087091"
     CDS             94..351
                     /gene="LOC106087091"
                     /codon_start=1
                     /product="V-type proton ATPase subunit e"
                     /protein_id="XP_013107452.1"
                     /db_xref="GeneID:106087091"
                     /translation="MGASFFPILFFTAIWASVGIGLPMMTPKGPHQNLIRCTLMLTGA
                     TCWLFWLCCYMAQMNPLIGPKLNQHAIFMIAREWGNTLKEG"
     misc_feature    112..288
                     /gene="LOC106087091"
                     /note="ATP synthase subunit H; Region: ATP_synt_H;
                     pfam05493"
                     /db_xref="CDD:461663"
     polyA_site      353
                     /gene="LOC106087091"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtaaaagtcg acttcgactt aaattcctag tgtgtgtata ttaacaaaaa aaattggtga
       61 ttgaataaaa ttgaaaaagc ttaaaaatac ataatgggag catcattttt tcctattctc
      121 ttcttcaccg ccatctgggc cagcgtgggt attggtctgc caatgatgac acctaaagga
      181 ccccatcaaa atctcatacg ttgcacttta atgttgactg gagcgacgtg ttggctattt
      241 tggctatgct gttacatggc ccaaatgaat cctttaatag gacccaaact aaatcaacat
      301 gccattttca tgattgccag agaatggggc aataccctga aggaaggcta aaa