Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106087015


LOCUS       XM_013251887            1025 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087015), mRNA.
ACCESSION   XM_013251887
VERSION     XM_013251887.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251887.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1025
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1025
                     /gene="LOC106087015"
                     /note="uncharacterized LOC106087015; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:106087015"
     CDS             314..757
                     /gene="LOC106087015"
                     /codon_start=1
                     /product="uncharacterized protein LOC106087015"
                     /protein_id="XP_013107341.1"
                     /db_xref="GeneID:106087015"
                     /translation="MWKILLQSAIVCAALSSVLAIECYVCDASDTKNPFQCGEWFERF
                     DEPDIQPSNCSNVHDAKFCIKHIGRFEGGIGAKRFCSSRDLGNYCDYVRNKGDRMEYR
                     SCIFTCSTDGCNSAPSVSQNQPPILSTLGVLVLMAATKMWLKSVS"
     misc_feature    374..661
                     /gene="LOC106087015"
                     /note="extracellular domain (ECD) found in Drosophila
                     melanogaster protein boudin and similar proteins; Region:
                     TFP_LU_ECD_Bou; cd23590"
                     /db_xref="CDD:467119"
     polyA_site      1025
                     /gene="LOC106087015"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtggagaaac gtcagtacct acttgacatt tgagtgtttt acttaggcgg acggacggac
       61 agactgtaac gacgggcttg gaattgaacg agcgagcgag cgagcggagc gcagcaaacg
      121 aacgaatatt aaaacaagtc aaatctagca aaacaagttg taaggtgggg ttagtgaaac
      181 attcttcttt tcgtttgttt gtttttttgg gtcttctatt cattcattca tttcgtcagc
      241 caaactccgt gaaaataacc cagaataata aagaaaatac aagaaaagag taacaaaatc
      301 aacaacttgc aatatgtgga aaattttgtt gcaaagtgca attgtgtgtg ccgctttaag
      361 ttcggttttg gccatcgagt gttatgtgtg cgatgcttcg gacaccaaaa atcccttcca
      421 gtgtggcgag tggtttgaac gcttcgacga acccgatatt caaccttcaa actgctcaaa
      481 tgtccatgat gccaaattct gcatcaagca cataggacgt ttcgagggag gcattggggc
      541 caaacgtttt tgctcctctc gcgacttggg caactattgt gattatgtac gcaacaaagg
      601 tgatcgcatg gagtacagat cgtgcatctt tacctgcagc acagatggct gcaacagtgc
      661 ccccagtgtt tcacaaaacc aacctcccat attgtccaca ttaggtgttc tagtgttaat
      721 ggctgccaca aaaatgtggc tgaaaagtgt gtcttaaacc tttaaaatct tcacatacag
      781 agttgtatta catcacattc ctaaagtgtt ggaggtgaag aatgcgtgtg tgtacttgtg
      841 tggtcatggg gtaataaact ctcagacaga ctttagtttt tttccgcaac tgtttaatgt
      901 atttctcgaa tagctttact gaaatgttag tctttaagtg ccttccttga tttatacaca
      961 aaaacttgac ttacaaatgt tttaaattgt taacaaataa aaagaaatta aaaagaaaat
     1021 tacaa