Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans endocuticle structural glycoprotein


LOCUS       XM_013251831             559 bp    mRNA    linear   INV 02-SEP-2023
            SgAbd-5 (LOC106086983), mRNA.
ACCESSION   XM_013251831
VERSION     XM_013251831.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251831.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..559
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..559
                     /gene="LOC106086983"
                     /note="endocuticle structural glycoprotein SgAbd-5;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon."
                     /db_xref="GeneID:106086983"
     CDS             148..459
                     /gene="LOC106086983"
                     /codon_start=1
                     /product="endocuticle structural glycoprotein SgAbd-5"
                     /protein_id="XP_013107285.1"
                     /db_xref="GeneID:106086983"
                     /translation="MKITFFFAISILFTAVLSAPQQDVQIVELENDNDGTGNYKFRFS
                     LSDGTKQDETGQLKDLQGEDGPVQAVVKTGSYEFTDPEGKLHRVTYTADENGFHPVVE
                     S"
     misc_feature    262..438
                     /gene="LOC106086983"
                     /note="Insect cuticle protein; Region: Chitin_bind_4;
                     pfam00379"
                     /db_xref="CDD:459790"
     polyA_site      559
                     /gene="LOC106086983"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgactgaca aagatgctgt cagtcatcat ctgcaaggaa caagccaaac tcggaatacc
       61 tacttgagcc cgcctttgtg aattttgata ttttgtaaag aacaaataaa ctccgtttac
      121 cctcggtaca caaatccagc acgaattatg aaaatcacat tcttctttgc gatcagcatt
      181 ctttttactg ctgttctaag tgcccctcaa caagatgtcc aaatagtgga gctggaaaat
      241 gataacgacg gcactggcaa ctacaaattt agattttccc tttctgatgg aacaaagcaa
      301 gacgaaactg gccagctaaa ggacctccag ggtgaagatg gtccggtaca agccgtcgtt
      361 aaaactggct cttacgaatt cacagatcct gaaggcaaat tgcatagagt aacgtacacg
      421 gccgacgaaa atggattcca tcctgttgta gaaagttaag attcctatga atacgatact
      481 tatgtagtta tctcgaagtg taaaataatt ctccattcac acataaatat ataaaaatac
      541 cggttatcaa acatcaaaa