Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013251831 559 bp mRNA linear INV 02-SEP-2023 SgAbd-5 (LOC106086983), mRNA. ACCESSION XM_013251831 VERSION XM_013251831.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013251831.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..559 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..559 /gene="LOC106086983" /note="endocuticle structural glycoprotein SgAbd-5; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106086983" CDS 148..459 /gene="LOC106086983" /codon_start=1 /product="endocuticle structural glycoprotein SgAbd-5" /protein_id="XP_013107285.1" /db_xref="GeneID:106086983" /translation="MKITFFFAISILFTAVLSAPQQDVQIVELENDNDGTGNYKFRFS LSDGTKQDETGQLKDLQGEDGPVQAVVKTGSYEFTDPEGKLHRVTYTADENGFHPVVE S" misc_feature 262..438 /gene="LOC106086983" /note="Insect cuticle protein; Region: Chitin_bind_4; pfam00379" /db_xref="CDD:459790" polyA_site 559 /gene="LOC106086983" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgactgaca aagatgctgt cagtcatcat ctgcaaggaa caagccaaac tcggaatacc 61 tacttgagcc cgcctttgtg aattttgata ttttgtaaag aacaaataaa ctccgtttac 121 cctcggtaca caaatccagc acgaattatg aaaatcacat tcttctttgc gatcagcatt 181 ctttttactg ctgttctaag tgcccctcaa caagatgtcc aaatagtgga gctggaaaat 241 gataacgacg gcactggcaa ctacaaattt agattttccc tttctgatgg aacaaagcaa 301 gacgaaactg gccagctaaa ggacctccag ggtgaagatg gtccggtaca agccgtcgtt 361 aaaactggct cttacgaatt cacagatcct gaaggcaaat tgcatagagt aacgtacacg 421 gccgacgaaa atggattcca tcctgttgta gaaagttaag attcctatga atacgatact 481 tatgtagtta tctcgaagtg taaaataatt ctccattcac acataaatat ataaaaatac 541 cggttatcaa acatcaaaa