Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013251827 1182 bp mRNA linear INV 02-SEP-2023 (LOC106086980), mRNA. ACCESSION XM_013251827 VERSION XM_013251827.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013251827.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1182 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1182 /gene="LOC106086980" /note="protein unc-119 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106086980" CDS 132..809 /gene="LOC106086980" /codon_start=1 /product="protein unc-119 homolog" /protein_id="XP_013107281.1" /db_xref="GeneID:106086980" /translation="MSVIGKQLNNLQSSNTATPPADNEKNLQSCTITPDDVLRLNKIS EDYLCSPNANIYDIDFTRFKIRDLESGAVLFEIAKPPSEQYVEANMDLMTATEDLTIE ETDPNAGRYVRYQFTPAFLSLTRVGATVEFTVGKLAVNNFRMIERHFFRDRLLKTFDF EFGYCIPYSKNSCEHIYEFPNLPPELVAEMISNPFETRSDSFYFVDNRLVMHNKADYA YDGGVAV" misc_feature 288..788 /gene="LOC106086980" /note="GMP-PDE, delta subunit; Region: GMP_PDE_delta; pfam05351" /db_xref="CDD:428436" polyA_site 1182 /gene="LOC106086980" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agcataaatt taggagaacg agccgaagga caaagattga ttcacttgtc acaaacaaac 61 agtttatttt attggctggt tttattattt ggctcttcgg gagtgtaaac taaagttggt 121 tattttgtac aatgagtgtt attggaaaac aattgaataa tttgcagtcg agtaacactg 181 caacccctcc tgctgataac gaaaaaaatc ttcaatcatg cacaataact cccgacgatg 241 tgctaagact aaacaaaata agcgaagatt acttgtgttc accaaatgca aacatttacg 301 atatcgattt tacccgtttc aagatacgcg atttggaaag tggggctgtg ctattcgaaa 361 tagcgaagcc tcctagtgaa caatacgtcg aagcaaatat ggatttgatg acagcaacgg 421 aagatctaac aatcgaagaa actgatccta acgctggacg ttacgttcgt tatcaattca 481 ctcccgcctt tctcagtttg accagagttg gcgcaactgt ggagtttaca gttggaaaat 541 tagcagtaaa taactttagg atgatcgaaa ggcacttttt ccgagaccgc ctattgaaaa 601 catttgattt tgagtttgga tactgcatac catattccaa aaacagctgc gaacacatat 661 acgagtttcc caatcttcct ccggagcttg ttgccgagat gatatcaaat ccatttgaaa 721 cgcgttcaga cagtttctac tttgttgaca atcgacttgt gatgcacaat aaggcagact 781 atgcgtacga tggaggagta gccgtttaag ttttgctata tgtaccagca ccagtactag 841 tcggaaatac tatatgtttt taattttgta acaatcatta ttgaccatac cgaatgtttg 901 tgtttcacca cagttaaaag tatgtcaagt cgcacttata attacatgcc ggtagccgga 961 tttgtgagta atctaaattg tattgattca tacataacac agcattggcc taaatagcca 1021 agcgtggccc aatacgtttc cagctcgaag tgcacaagtt ttcacattat atttttacta 1081 agtatgaaat tttaataaat tgccttatgc ttggggtact tcttatagct ctaaatgcga 1141 gtataagaaa gtacatacaa acatacaaaa aaatgtaaat ta