Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans transmembrane protein 256-like


LOCUS       XM_013251745             928 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086924), transcript variant X2, mRNA.
ACCESSION   XM_013251745
VERSION     XM_013251745.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251745.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..928
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..928
                     /gene="LOC106086924"
                     /note="transmembrane protein 256-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:106086924"
     CDS             229..759
                     /gene="LOC106086924"
                     /codon_start=1
                     /product="transmembrane protein 256-like isoform X2"
                     /protein_id="XP_013107199.2"
                     /db_xref="GeneID:106086924"
                     /translation="MTIADSLHYIAVGNPLSKFTMNAANSLLGRSSAMRSVSNLNTVN
                     ASLMSGNLVKAMPPLWELAGHNRNFVRLAGLSGAAAVILGAIGSHNAKFKDNAEMRAV
                     FDTANRFHFFHSIALMGIPLARYPMVTGSLMLVGMSLFSGCLYYRAFTGNKPPFARMA
                     PMGGTLLIVAWLSLLL"
     polyA_site      928
                     /gene="LOC106086924"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctcagtaaca attctcactg ccggcatcat gttcataaat aataaagctg ccggaattaa
       61 aacaagatag accgtgtttg ctaccaacct tttggtgcat tatctgcgtc gccattattt
      121 tcttataaca cgagaaaaaa ttctgaattt ttgcaccttt taacgtcaaa tttcaagcaa
      181 acattcaatt tggaagtgga aagaaagata cttggaagtc gaagcaaaat gacgattgca
      241 gatagtttgc attatattgc cgttgggaat cccctaagta aatttacaat gaacgcagca
      301 aattcgttat tgggccgcag ctctgctatg aggtctgtaa gcaatcttaa tacagtaaat
      361 gcatctttga tgtccgggaa tttagtaaaa gctatgcctc cattgtggga gttggcaggc
      421 cataatcgga attttgtacg tttggctggt ttaagcgggg cggctgcagt catcctggga
      481 gcgattggta gccacaatgc aaagtttaaa gataatgctg aaatgcgagc tgtttttgac
      541 acagctaacc ggtttcattt ctttcactca atagccctaa tgggtattcc attggctagg
      601 tatcccatgg tgacaggctc tttgatgtta gttggcatgt ccctttttag tggatgtctt
      661 tattatcgcg cttttactgg aaataagcca ccctttgctc gaatggctcc tatgggagga
      721 actctgctga ttgtagcttg gctctctttg ttgctataat gcagaaaaat ccttggataa
      781 aaatgttgca gaaaattggt gtagtaccaa actggagcct gattctattt tattgaaatt
      841 ctttaatact tatatgatat tttccaaatt tgtattcatg atttttctac tgccgatatg
      901 ggaattaaaa cttttgtatg tattttga