Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans transmembrane protein 256-like


LOCUS       XM_013251744             940 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086924), transcript variant X1, mRNA.
ACCESSION   XM_013251744
VERSION     XM_013251744.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251744.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..940
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..940
                     /gene="LOC106086924"
                     /note="transmembrane protein 256-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:106086924"
     CDS             229..771
                     /gene="LOC106086924"
                     /codon_start=1
                     /product="transmembrane protein 256-like isoform X1"
                     /protein_id="XP_013107198.2"
                     /db_xref="GeneID:106086924"
                     /translation="MTIADSLHYIAVGNPLSKFTMNAANSLLGRSSAMRVNAMSVSNL
                     NTVNASLMSGNLVKAMPPLWELAGHNRNFVRLAGLSGAAAVILGAIGSHNAKFKDNAE
                     MRAVFDTANRFHFFHSIALMGIPLARYPMVTGSLMLVGMSLFSGCLYYRAFTGNKPPF
                     ARMAPMGGTLLIVAWLSLLL"
     polyA_site      940
                     /gene="LOC106086924"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctcagtaaca attctcactg ccggcatcat gttcataaat aataaagctg ccggaattaa
       61 aacaagatag accgtgtttg ctaccaacct tttggtgcat tatctgcgtc gccattattt
      121 tcttataaca cgagaaaaaa ttctgaattt ttgcaccttt taacgtcaaa tttcaagcaa
      181 acattcaatt tggaagtgga aagaaagata cttggaagtc gaagcaaaat gacgattgca
      241 gatagtttgc attatattgc cgttgggaat cccctaagta aatttacaat gaacgcagca
      301 aattcgttat tgggccgcag ctctgctatg agggtaaatg caatgtctgt aagcaatctt
      361 aatacagtaa atgcatcttt gatgtccggg aatttagtaa aagctatgcc tccattgtgg
      421 gagttggcag gccataatcg gaattttgta cgtttggctg gtttaagcgg ggcggctgca
      481 gtcatcctgg gagcgattgg tagccacaat gcaaagttta aagataatgc tgaaatgcga
      541 gctgtttttg acacagctaa ccggtttcat ttctttcact caatagccct aatgggtatt
      601 ccattggcta ggtatcccat ggtgacaggc tctttgatgt tagttggcat gtcccttttt
      661 agtggatgtc tttattatcg cgcttttact ggaaataagc caccctttgc tcgaatggct
      721 cctatgggag gaactctgct gattgtagct tggctctctt tgttgctata atgcagaaaa
      781 atccttggat aaaaatgttg cagaaaattg gtgtagtacc aaactggagc ctgattctat
      841 tttattgaaa ttctttaata cttatatgat attttccaaa tttgtattca tgatttttct
      901 actgccgata tgggaattaa aacttttgta tgtattttga