PREDICTED: Stomoxys calcitrans antigen 5 like allergen Cul n 1-like

LOCUS       XM_013251727             822 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086908), mRNA.
ACCESSION   XM_013251727
VERSION     XM_013251727.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251727.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 30% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..822
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..822
                     /gene="LOC106086908"
                     /note="antigen 5 like allergen Cul n 1-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:106086908"
     CDS             34..822
                     /gene="LOC106086908"
                     /codon_start=1
                     /product="antigen 5 like allergen Cul n 1-like"
                     /protein_id="XP_013107181.1"
                     /db_xref="GeneID:106086908"
                     /translation="MVTHNGFLIVLLLAVVGSSLAFDYCNDKDTKCCGYKHIACKNNK
                     QFGPQCKRSATIIPMTQDLINIILHGHNEARNLMANGTYGFPTARRLGVIAWENSLAQ
                     VADYNVRQCNPVMDQCRNTLYFKFVGQNIGISNWNSREQQYTVEEVIRHQIRKWISQR
                     RFATTKDMQSYPFKLPEITFGHFAVMMLQKANRVGCAIQRETEPDGYVRQAMTCNYSH
                     DLVVGQPVYAMGPTASACNAGISPVYPNLCTVFEAMYPNQIGVF"
     misc_feature    223..684
                     /gene="LOC106086908"
                     /note="Eukaryotic CAP (cysteine-rich secretory proteins,
                     antigen 5, and pathogenesis-related 1 proteins) domain
                     proteins; Region: CAP_euk; cd05380"
                     /db_xref="CDD:349399"
ORIGIN      
        1 ggtgtagcag agtttttagc gatttaagtt ataatggtta cgcataacgg atttctgatt
       61 gtcctactat tggcggtggt gggcagctca ttggcattcg attattgcaa tgacaaagat
      121 acaaaatgtt gtggttacaa acatatcgcc tgtaaaaata ataagcaatt tgggccacaa
      181 tgtaaaagat ctgccaccat tataccgatg actcaagatc ttattaacat tatccttcat
      241 ggtcacaacg aggcacgtaa cctaatggcc aatggtacct atggcttccc aacagccaga
      301 cgcttgggag ttatcgcttg ggagaacagt ttagcccagg tggctgacta taatgtcaga
      361 caatgtaacc ccgtcatgga tcaatgccgc aacactttat atttcaaatt cgttggacaa
      421 aatataggca tatccaactg gaactccaga gagcagcaat acactgtcga agaagttata
      481 cgtcatcaaa taagaaaatg gatctcacaa cggcgttttg cgaccaccaa agatatgcaa
      541 tcttatcctt tcaagctacc agaaattacc ttcggacatt ttgccgttat gatgcttcaa
      601 aaggcaaatc gagtaggatg tgccatacag cgggaaacgg aacctgatgg ttatgtacgc
      661 caggctatga catgcaacta ctcgcacgat cttgttgtcg gacaacccgt ttatgctatg
      721 ggcccaactg cttcagcctg taacgctggt atcagccccg tctacccaaa tctgtgtaca
      781 gtttttgagg ctatgtatcc aaatcaaatt ggcgtttttt ga