Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans antigen 5 like allergen Cul n 1


LOCUS       XM_013251726             856 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086907), mRNA.
ACCESSION   XM_013251726
VERSION     XM_013251726.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251726.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..856
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..856
                     /gene="LOC106086907"
                     /note="antigen 5 like allergen Cul n 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 28 Proteins"
                     /db_xref="GeneID:106086907"
     CDS             20..814
                     /gene="LOC106086907"
                     /codon_start=1
                     /product="antigen 5 like allergen Cul n 1"
                     /protein_id="XP_013107180.2"
                     /db_xref="GeneID:106086907"
                     /translation="MSAFDRLCALLLLLGAAHYSLAGETNYCDLDLCYGFEGHIACNN
                     TGGFAPICASDVKIIPIRPELQEAIIFRHNLYRNAIAGGWGQYKPAAHMALTRWNPEL
                     ARLAELNVRRCDAEHDLCRNTNDFNFAGQNIGVIYHRGNDFDAEQTALHQIDTWFAES
                     DLASMDTINEYRTPEDGTQIGSFTGMVQEMGNQMGCAILQQTVIEDIVQQILTCNYSY
                     INIEGLPVYIPGEPGSKCTTGTDPTFKALCSANEFYDVNDIPHYKE"
ORIGIN      
        1 aattcaacag aatacaaaaa tgtccgcatt cgatagactg tgtgcccttc tattgttgtt
       61 gggagctgca cactattctt tggcaggcga aactaactac tgtgacctcg atctttgcta
      121 tggtttcgag ggtcatattg catgtaacaa cactgggggt ttcgctccca tatgcgcttc
      181 tgatgtcaaa ataatcccca ttaggccgga acttcaagag gccatcatat tccgacacaa
      241 tctttatcga aatgctatag ctggtggctg gggtcaatac aaaccagctg ctcacatggc
      301 cctgacacgt tggaatcccg aattggctcg tttagctgaa ctgaatgtac gacgatgtga
      361 tgctgaacat gatctatgcc gcaatactaa cgattttaat tttgctggac aaaatattgg
      421 agtaatctac cacagaggaa atgattttga tgccgaacag acggctctcc atcaaataga
      481 cacttggttt gccgaaagtg atcttgcttc gatggacacc atcaatgagt atagaacacc
      541 agaagatggt acacaaattg gttcctttac tggcatggtt caggaaatgg gtaaccaaat
      601 gggttgtgcc attttgcaac agacagttat agaagatatt gtgcaacaaa tcttaacatg
      661 caattattcc tacatcaata ttgaaggtct acccgtttat ataccaggtg aacctggtag
      721 taaatgcaca actggaactg accccacctt caaggcgttg tgtagcgcca acgagtttta
      781 cgatgtaaat gatattcctc attataaaga ataatagtaa tagataatta gtggatataa
      841 ttaatacaat tttaaa