Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013251726 856 bp mRNA linear INV 02-SEP-2023 (LOC106086907), mRNA. ACCESSION XM_013251726 VERSION XM_013251726.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013251726.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..856 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..856 /gene="LOC106086907" /note="antigen 5 like allergen Cul n 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 28 Proteins" /db_xref="GeneID:106086907" CDS 20..814 /gene="LOC106086907" /codon_start=1 /product="antigen 5 like allergen Cul n 1" /protein_id="XP_013107180.2" /db_xref="GeneID:106086907" /translation="MSAFDRLCALLLLLGAAHYSLAGETNYCDLDLCYGFEGHIACNN TGGFAPICASDVKIIPIRPELQEAIIFRHNLYRNAIAGGWGQYKPAAHMALTRWNPEL ARLAELNVRRCDAEHDLCRNTNDFNFAGQNIGVIYHRGNDFDAEQTALHQIDTWFAES DLASMDTINEYRTPEDGTQIGSFTGMVQEMGNQMGCAILQQTVIEDIVQQILTCNYSY INIEGLPVYIPGEPGSKCTTGTDPTFKALCSANEFYDVNDIPHYKE" ORIGIN 1 aattcaacag aatacaaaaa tgtccgcatt cgatagactg tgtgcccttc tattgttgtt 61 gggagctgca cactattctt tggcaggcga aactaactac tgtgacctcg atctttgcta 121 tggtttcgag ggtcatattg catgtaacaa cactgggggt ttcgctccca tatgcgcttc 181 tgatgtcaaa ataatcccca ttaggccgga acttcaagag gccatcatat tccgacacaa 241 tctttatcga aatgctatag ctggtggctg gggtcaatac aaaccagctg ctcacatggc 301 cctgacacgt tggaatcccg aattggctcg tttagctgaa ctgaatgtac gacgatgtga 361 tgctgaacat gatctatgcc gcaatactaa cgattttaat tttgctggac aaaatattgg 421 agtaatctac cacagaggaa atgattttga tgccgaacag acggctctcc atcaaataga 481 cacttggttt gccgaaagtg atcttgcttc gatggacacc atcaatgagt atagaacacc 541 agaagatggt acacaaattg gttcctttac tggcatggtt caggaaatgg gtaaccaaat 601 gggttgtgcc attttgcaac agacagttat agaagatatt gtgcaacaaa tcttaacatg 661 caattattcc tacatcaata ttgaaggtct acccgtttat ataccaggtg aacctggtag 721 taaatgcaca actggaactg accccacctt caaggcgttg tgtagcgcca acgagtttta 781 cgatgtaaat gatattcctc attataaaga ataatagtaa tagataatta gtggatataa 841 ttaatacaat tttaaa