Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans antigen 5 like allergen Cul n 1-like


LOCUS       XM_013251725             925 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086905), mRNA.
ACCESSION   XM_013251725
VERSION     XM_013251725.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251725.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..925
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..925
                     /gene="LOC106086905"
                     /note="antigen 5 like allergen Cul n 1-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 39 Proteins"
                     /db_xref="GeneID:106086905"
     CDS             35..829
                     /gene="LOC106086905"
                     /codon_start=1
                     /product="antigen 5 like allergen Cul n 1-like"
                     /protein_id="XP_013107179.2"
                     /db_xref="GeneID:106086905"
                     /translation="MARCTSIALLIYLFAYEVSATTTTYSKFLTFSENPCNYCSTHIA
                     CRNTWKFPDSCNLNAEFVTMTPELRNFLMDLHNERRNILAGGNQKGYLPAVRMATMSW
                     NYEFEYLSALNLLQCDLKHDKCRRTPTHPYVGQNLASLTWNTKELSIEEILTLLVDYW
                     YKEHQYITMDHIKYFPRANLPHAIGHFTQMAQERANEVGCAVMRHSSEDLRHVLLACN
                     YSFANFYNVTIYRHGSAASKCQTGVNTKYTNLCSAREKYNTSSLVY"
     polyA_site      925
                     /gene="LOC106086905"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attgcgctgc aactattttt aaatttctgc aagcatggcc cgctgtacga gtatagcttt
       61 gttaatatat ctatttgcct atgaagtttc agccaccacg acaacttatt ccaaattttt
      121 aacgtttagt gaaaaccctt gcaattattg tagtacacac atagcttgta gaaacacatg
      181 gaaatttccc gactcttgta atctgaatgc agaattcgta acaatgacac ctgaattgcg
      241 aaactttttg atggacttac ataacgaacg ccgtaatatt ttagctggag gcaatcaaaa
      301 aggttaccta cctgcggttc gcatggctac aatgtcctgg aattatgaat ttgaatatct
      361 atctgctttg aatcttttgc aatgcgattt gaaacacgat aaatgtcgcc gaacacccac
      421 ccatccctat gtaggacaaa atttggcatc tctgacatgg aatacgaagg aattaagcat
      481 tgaggagata ctcacattgc tggtggatta ttggtacaaa gaacaccaat atataacaat
      541 ggaccatatc aaatattttc cgcgagcgaa tttaccacat gcaattggac acttcaccca
      601 gatggctcaa gagcgtgcaa atgaagtcgg ttgtgccgta atgcgtcatt cgagcgaaga
      661 cctaaggcat gtgctcttgg cttgcaatta ttcatttgca aacttctaca atgtgaccat
      721 ctatagacat ggatctgcgg cctctaaatg ccagacaggg gttaacacaa aatatacaaa
      781 tctatgttcg gctagggaaa aatataacac tagtagcttg gtttactaga aacaaggaaa
      841 atacaatttc ggtataaaca aaaaattaaa ttttaataaa attattaacg ttgaacaaaa
      901 ttttaaaata tgttaaaaat tttaa