Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013251725 925 bp mRNA linear INV 02-SEP-2023 (LOC106086905), mRNA. ACCESSION XM_013251725 VERSION XM_013251725.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013251725.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..925 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..925 /gene="LOC106086905" /note="antigen 5 like allergen Cul n 1-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 39 Proteins" /db_xref="GeneID:106086905" CDS 35..829 /gene="LOC106086905" /codon_start=1 /product="antigen 5 like allergen Cul n 1-like" /protein_id="XP_013107179.2" /db_xref="GeneID:106086905" /translation="MARCTSIALLIYLFAYEVSATTTTYSKFLTFSENPCNYCSTHIA CRNTWKFPDSCNLNAEFVTMTPELRNFLMDLHNERRNILAGGNQKGYLPAVRMATMSW NYEFEYLSALNLLQCDLKHDKCRRTPTHPYVGQNLASLTWNTKELSIEEILTLLVDYW YKEHQYITMDHIKYFPRANLPHAIGHFTQMAQERANEVGCAVMRHSSEDLRHVLLACN YSFANFYNVTIYRHGSAASKCQTGVNTKYTNLCSAREKYNTSSLVY" polyA_site 925 /gene="LOC106086905" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attgcgctgc aactattttt aaatttctgc aagcatggcc cgctgtacga gtatagcttt 61 gttaatatat ctatttgcct atgaagtttc agccaccacg acaacttatt ccaaattttt 121 aacgtttagt gaaaaccctt gcaattattg tagtacacac atagcttgta gaaacacatg 181 gaaatttccc gactcttgta atctgaatgc agaattcgta acaatgacac ctgaattgcg 241 aaactttttg atggacttac ataacgaacg ccgtaatatt ttagctggag gcaatcaaaa 301 aggttaccta cctgcggttc gcatggctac aatgtcctgg aattatgaat ttgaatatct 361 atctgctttg aatcttttgc aatgcgattt gaaacacgat aaatgtcgcc gaacacccac 421 ccatccctat gtaggacaaa atttggcatc tctgacatgg aatacgaagg aattaagcat 481 tgaggagata ctcacattgc tggtggatta ttggtacaaa gaacaccaat atataacaat 541 ggaccatatc aaatattttc cgcgagcgaa tttaccacat gcaattggac acttcaccca 601 gatggctcaa gagcgtgcaa atgaagtcgg ttgtgccgta atgcgtcatt cgagcgaaga 661 cctaaggcat gtgctcttgg cttgcaatta ttcatttgca aacttctaca atgtgaccat 721 ctatagacat ggatctgcgg cctctaaatg ccagacaggg gttaacacaa aatatacaaa 781 tctatgttcg gctagggaaa aatataacac tagtagcttg gtttactaga aacaaggaaa 841 atacaatttc ggtataaaca aaaaattaaa ttttaataaa attattaacg ttgaacaaaa 901 ttttaaaata tgttaaaaat tttaa