Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans splicing factor U2AF 50 kDa subunit


LOCUS       XM_013251720            1634 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086900), mRNA.
ACCESSION   XM_013251720
VERSION     XM_013251720.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251720.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1634
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1634
                     /gene="LOC106086900"
                     /note="splicing factor U2AF 50 kDa subunit; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 12 Proteins"
                     /db_xref="GeneID:106086900"
     CDS             127..1431
                     /gene="LOC106086900"
                     /codon_start=1
                     /product="splicing factor U2AF 50 kDa subunit"
                     /protein_id="XP_013107174.2"
                     /db_xref="GeneID:106086900"
                     /translation="MGSDDRDRRRHRSRSRSRDRRRSRSRDRRDRRDERGMANIPGAS
                     SGPRGRGNYTRRRKPSLYWDVPPPGFEHITPLQYKAMQASGQIPANTVPDIPQAAVPV
                     VGSTITRQARRLYVGNIPFGVTEDEMMEFFNQQMHLTGLAQADGNPVLACQINLDKNF
                     AFLEFRSTDETTQAMAFDGINFKGQSLKIRRPHDYQPMPGVVDASPMPQPVSNGVIST
                     VVPDSPHKIFIGGLPNYLNEEQVKELLLSFGQLRAFNLVKDTGTGLSKGYAFTEYVDH
                     TITDQAIAGLNGMQLGDKKLIVQRASVGAKNAQNNSTTAAPVTIQVPGLAMLGISGPP
                     TEVLCLLNMVTPDELRDEDEYEDILDDIKEECNKYGVVRSVEIPRPIEGVDVPGCGKV
                     FVEFNSVMDCQKAQQALTGRKFSDRVVVTSYFDPDKYHRREF"
     polyA_site      1634
                     /gene="LOC106086900"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atcaccctgt gtcaaaataa gcgaggagcg tacatagaaa aaaattgcca aaattattta
       61 tactagcgag taaagactaa gtattgtgtt gtaaaaacta ctgcatcaga cgcaaatact
      121 taaaaaatgg gttccgatga ccgtgacaga cgccgccaca ggagcagatc tcgttcgcgc
      181 gatagacgcc gttcacgttc ccgtgatcgt cgcgacagac gcgatgagcg gggaatggcc
      241 aatatcccag gtgccagcag tgggcccagg ggacgaggca attataccag acgccgcaaa
      301 ccttcattgt attgggatgt accgccacca ggatttgagc atataacacc actgcaatac
      361 aaggctatgc aggcctctgg tcaaatccct gcaaatacag tgcccgatat accacaagct
      421 gcggtgcccg tcgttggttc cacaattacc agacaggcac gacgtctata tgtgggcaat
      481 ataccgtttg gcgtgaccga agatgaaatg atggagttct tcaatcagca aatgcattta
      541 accggtctgg cacaggctga tggcaatccg gtattggctt gccaaatcaa tttggacaag
      601 aattttgcat tcctcgagtt ccgttcgaca gatgaaacca cccaagccat ggcattcgat
      661 ggaattaatt ttaagggaca aagtttgaaa atacgccgac cccacgatta tcaaccaatg
      721 ccaggagtgg tggatgcctc gcctatgcca caaccagtct ctaatggtgt aatatctaca
      781 gtggtgccag actctccgca taagattttc attggtggcc tgccaaatta tttgaacgag
      841 gaacaggtca aagagcttct attatccttt ggccagttaa gggccttcaa tttggttaag
      901 gatactggca caggtctaag caaaggttat gctttcaccg aatatgtgga tcataccata
      961 acagatcaag ctattgccgg tcttaatggc atgcagttgg gcgataagaa gctcattgtg
     1021 caacgtgcca gcgtgggggc taaaaatgct caaaataatt caactaccgc tgctcccgtt
     1081 accatccaag tacccggtct ggcaatgctg ggcatttcag gaccacccac cgaagttttg
     1141 tgtctcttga acatggttac gcccgatgag ttgcgtgacg aggacgaata cgaggacatt
     1201 ctcgatgata tcaaagagga atgcaataaa tatggtgtag ttcgtagcgt ggaaataccc
     1261 cgacccatcg aaggggtcga tgttccgggt tgtggtaaag tctttgtaga attcaattcc
     1321 gttatggact gtcagaaggc ccaacaagcc ttgacgggcc gcaaatttag cgatcgtgtt
     1381 gtggttacct cctactttga cccagataag tatcatcgcc gtgaattcta agaagtgtat
     1441 tccccacccc acccctcctc gaacacataa cacaaaaact acagacctat aattgagtga
     1501 acacaaatgt tcgtataccc taacccttac aagactatct tcatatgaat gtgtgtgtgt
     1561 tttttttttt ctttttcttt atgcaaaagt caagcgtata ttgtagctat aaatttctta
     1621 tacatgcata tgta