Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans glutaredoxin 3 (LOC106086819), mRNA.


LOCUS       XM_013251633             813 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_013251633
VERSION     XM_013251633.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251633.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..813
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..813
                     /gene="LOC106086819"
                     /note="glutaredoxin 3; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 10 Proteins"
                     /db_xref="GeneID:106086819"
     CDS             90..731
                     /gene="LOC106086819"
                     /codon_start=1
                     /product="glutaredoxin 3"
                     /protein_id="XP_013107087.2"
                     /db_xref="GeneID:106086819"
                     /translation="MPVSVIKSEDDYKKLMSAEKTSAVLFSAEWAEQCQQVSDVMEDL
                     SKLLHDKLEFVVITAEDYPDIAMKHQIEAVPTVIFFAKGTAVDRVDGVDIASLTAKCK
                     ELGAAATSEQPLEERLKALVNKAPLMIFMKGDRDAPRCGFSKQLIAIVNELGLPYQTF
                     DILTDEEVRQGLKTYSDWPTYPQVYVKGELIGGLDIIKELKANNELEQTLKGE"
     polyA_site      813
                     /gene="LOC106086819"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 taacctaaaa cttttgacat ttccattcga acaaaagtct tgcaaaatca aaatcattaa
       61 atacaaaata aaaactttta aactacaaaa tgccagtgtc tgtaattaaa tccgaagatg
      121 actacaaaaa gttgatgagt gccgaaaaga cttccgcagt tctattctcc gccgaatggg
      181 ctgaacaatg ccaacaagtg tctgatgtca tggaagacct gagtaaatta ctacacgata
      241 agttggaatt tgttgtgata actgccgaag attatcccga tatcgccatg aaacaccaga
      301 ttgaagctgt gccaactgtg atatttttcg ctaaaggtac cgctgtagat cgtgtggatg
      361 gcgttgatat agcatcgctg acagcaaagt gtaaagaatt gggtgcagct gctactagtg
      421 agcaaccttt agaagaacgt ttgaaggccc ttgtaaacaa agcgccctta atgatattca
      481 tgaaagggga cagagatgcg ccacgttgtg gattttccaa acaacttatc gcaatagtga
      541 acgagcttgg tcttccgtat caaacattcg acattttgac tgatgaagaa gttcgccaag
      601 gcttaaaaac atactccgat tggcctacat atccccaagt ttatgttaaa ggggaactta
      661 taggtggtct ggatataatt aaagaactga aggctaacaa tgaattggag cagacgttaa
      721 aaggcgaata atggtaaaga caacaaaaat attttcatac aaacttgtga gactattatt
      781 tttacaaata aacgaataat tataggaaac taa