Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013251633 813 bp mRNA linear INV 02-SEP-2023 ACCESSION XM_013251633 VERSION XM_013251633.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013251633.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..813 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..813 /gene="LOC106086819" /note="glutaredoxin 3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106086819" CDS 90..731 /gene="LOC106086819" /codon_start=1 /product="glutaredoxin 3" /protein_id="XP_013107087.2" /db_xref="GeneID:106086819" /translation="MPVSVIKSEDDYKKLMSAEKTSAVLFSAEWAEQCQQVSDVMEDL SKLLHDKLEFVVITAEDYPDIAMKHQIEAVPTVIFFAKGTAVDRVDGVDIASLTAKCK ELGAAATSEQPLEERLKALVNKAPLMIFMKGDRDAPRCGFSKQLIAIVNELGLPYQTF DILTDEEVRQGLKTYSDWPTYPQVYVKGELIGGLDIIKELKANNELEQTLKGE" polyA_site 813 /gene="LOC106086819" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 taacctaaaa cttttgacat ttccattcga acaaaagtct tgcaaaatca aaatcattaa 61 atacaaaata aaaactttta aactacaaaa tgccagtgtc tgtaattaaa tccgaagatg 121 actacaaaaa gttgatgagt gccgaaaaga cttccgcagt tctattctcc gccgaatggg 181 ctgaacaatg ccaacaagtg tctgatgtca tggaagacct gagtaaatta ctacacgata 241 agttggaatt tgttgtgata actgccgaag attatcccga tatcgccatg aaacaccaga 301 ttgaagctgt gccaactgtg atatttttcg ctaaaggtac cgctgtagat cgtgtggatg 361 gcgttgatat agcatcgctg acagcaaagt gtaaagaatt gggtgcagct gctactagtg 421 agcaaccttt agaagaacgt ttgaaggccc ttgtaaacaa agcgccctta atgatattca 481 tgaaagggga cagagatgcg ccacgttgtg gattttccaa acaacttatc gcaatagtga 541 acgagcttgg tcttccgtat caaacattcg acattttgac tgatgaagaa gttcgccaag 601 gcttaaaaac atactccgat tggcctacat atccccaagt ttatgttaaa ggggaactta 661 taggtggtct ggatataatt aaagaactga aggctaacaa tgaattggag cagacgttaa 721 aaggcgaata atggtaaaga caacaaaaat attttcatac aaacttgtga gactattatt 781 tttacaaata aacgaataat tataggaaac taa