Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013251627 975 bp mRNA linear INV 02-SEP-2023 mitochondrial (LOC106086815), mRNA. ACCESSION XM_013251627 VERSION XM_013251627.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013251627.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..975 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..975 /gene="LOC106086815" /note="ATP synthase subunit delta, mitochondrial; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:106086815" CDS 118..591 /gene="LOC106086815" /codon_start=1 /product="ATP synthase subunit delta, mitochondrial" /protein_id="XP_013107081.1" /db_xref="GeneID:106086815" /translation="MSFVKNARLLATRGARMVQSRGYADEMKLTFAAANKTFYDNADV RQIDVPSFSGSFGILAKHVPTLAVLKPGVVQVYENDGKTTKYFVSSGTISVNEDSSVQ VLAEEAHNIADIDVAEARQLLSQYQSALTSASSDQAKAEAAIAVECCEALVKAAE" misc_feature 196..570 /gene="LOC106086815" /note="mitochondrial ATP synthase delta subunit; Region: F1-ATPase_delta; cd12152" /db_xref="CDD:213395" misc_feature order(205..207,214..222,226..228,235..237,304..318, 385..402,421..423,427..435) /gene="LOC106086815" /note="gamma subunit interface [polypeptide binding]; other site" /db_xref="CDD:213395" misc_feature order(220..222,271..273,319..324,328..330,376..378, 382..390,433..438,442..444,451..456,460..462,481..483, 535..540,544..549,556..558,562..564) /gene="LOC106086815" /note="epsilon subunit interface [polypeptide binding]; other site" /db_xref="CDD:213395" misc_feature order(253..255,259..261,277..282,286..288,292..294, 298..306,346..348) /gene="LOC106086815" /note="LBP interface [polypeptide binding]; other site" /db_xref="CDD:213395" polyA_site 975 /gene="LOC106086815" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgtcgcact tgacatttcg tatttttgga gaaccaatac cgacaccaag ggttttcaag 61 caatttccac ggtttttact ggaaatacta aaacagcaaa ttaaatacta gctcacaatg 121 tctttcgtta agaacgctcg tttgttggcc actcgtggtg cccgtatggt tcaaagccgc 181 ggctatgccg atgagatgaa actcacattt gctgccgcca acaagacctt ctacgataat 241 gctgatgtgc gtcaaattga tgtcccatcc ttcagtggca gctttggtat tttggctaag 301 cacgtaccaa ctttggctgt cttgaaaccc ggagttgtcc aagtctatga aaatgacggc 361 aaaactacca aatactttgt ttccagtggc accatctctg ttaacgaaga ttcttcagtc 421 caagttttgg ctgaagaagc tcataacatt gctgatattg atgtagcaga agctcgtcaa 481 ttgttgagcc agtaccaatc agctcttacc tctgcctctt cggaccaggc taaggctgaa 541 gctgccattg ctgttgaatg ctgtgaagct ctcgtcaaag ctgccgaata aatttaattt 601 tcttgtgttt tagtataaaa actagctcct tggagcaaaa caaaagaagc accatctttt 661 cattgattcc gttgtaactt aacaaacaaa atcttattta agtataaaaa atgtgtggtt 721 ttcaaaaaac cagcccgtca ccacaacaaa tgttttcttc caatttgtta gccaagattc 781 aagctgggtg agaacgagag agagagagag agataaatac aactagtgag agatacacgg 841 acagattaca tacacacaaa atgccagctt ttgaacttct tttgatacat gaatgaatga 901 atatccagag ttgttgatgt tggttacgat tatgaaatat tcaaatacca aacaataaaa 961 taatgcgaaa aaacc