Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans ATP synthase subunit delta,


LOCUS       XM_013251627             975 bp    mRNA    linear   INV 02-SEP-2023
            mitochondrial (LOC106086815), mRNA.
ACCESSION   XM_013251627
VERSION     XM_013251627.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251627.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..975
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..975
                     /gene="LOC106086815"
                     /note="ATP synthase subunit delta, mitochondrial; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 13 Proteins"
                     /db_xref="GeneID:106086815"
     CDS             118..591
                     /gene="LOC106086815"
                     /codon_start=1
                     /product="ATP synthase subunit delta, mitochondrial"
                     /protein_id="XP_013107081.1"
                     /db_xref="GeneID:106086815"
                     /translation="MSFVKNARLLATRGARMVQSRGYADEMKLTFAAANKTFYDNADV
                     RQIDVPSFSGSFGILAKHVPTLAVLKPGVVQVYENDGKTTKYFVSSGTISVNEDSSVQ
                     VLAEEAHNIADIDVAEARQLLSQYQSALTSASSDQAKAEAAIAVECCEALVKAAE"
     misc_feature    196..570
                     /gene="LOC106086815"
                     /note="mitochondrial ATP synthase delta subunit; Region:
                     F1-ATPase_delta; cd12152"
                     /db_xref="CDD:213395"
     misc_feature    order(205..207,214..222,226..228,235..237,304..318,
                     385..402,421..423,427..435)
                     /gene="LOC106086815"
                     /note="gamma subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213395"
     misc_feature    order(220..222,271..273,319..324,328..330,376..378,
                     382..390,433..438,442..444,451..456,460..462,481..483,
                     535..540,544..549,556..558,562..564)
                     /gene="LOC106086815"
                     /note="epsilon subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213395"
     misc_feature    order(253..255,259..261,277..282,286..288,292..294,
                     298..306,346..348)
                     /gene="LOC106086815"
                     /note="LBP interface [polypeptide binding]; other site"
                     /db_xref="CDD:213395"
     polyA_site      975
                     /gene="LOC106086815"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgtcgcact tgacatttcg tatttttgga gaaccaatac cgacaccaag ggttttcaag
       61 caatttccac ggtttttact ggaaatacta aaacagcaaa ttaaatacta gctcacaatg
      121 tctttcgtta agaacgctcg tttgttggcc actcgtggtg cccgtatggt tcaaagccgc
      181 ggctatgccg atgagatgaa actcacattt gctgccgcca acaagacctt ctacgataat
      241 gctgatgtgc gtcaaattga tgtcccatcc ttcagtggca gctttggtat tttggctaag
      301 cacgtaccaa ctttggctgt cttgaaaccc ggagttgtcc aagtctatga aaatgacggc
      361 aaaactacca aatactttgt ttccagtggc accatctctg ttaacgaaga ttcttcagtc
      421 caagttttgg ctgaagaagc tcataacatt gctgatattg atgtagcaga agctcgtcaa
      481 ttgttgagcc agtaccaatc agctcttacc tctgcctctt cggaccaggc taaggctgaa
      541 gctgccattg ctgttgaatg ctgtgaagct ctcgtcaaag ctgccgaata aatttaattt
      601 tcttgtgttt tagtataaaa actagctcct tggagcaaaa caaaagaagc accatctttt
      661 cattgattcc gttgtaactt aacaaacaaa atcttattta agtataaaaa atgtgtggtt
      721 ttcaaaaaac cagcccgtca ccacaacaaa tgttttcttc caatttgtta gccaagattc
      781 aagctgggtg agaacgagag agagagagag agataaatac aactagtgag agatacacgg
      841 acagattaca tacacacaaa atgccagctt ttgaacttct tttgatacat gaatgaatga
      901 atatccagag ttgttgatgt tggttacgat tatgaaatat tcaaatacca aacaataaaa
      961 taatgcgaaa aaacc