PREDICTED: Stomoxys calcitrans uncharacterized LOC106086601

LOCUS       XM_013251342             597 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086601), mRNA.
ACCESSION   XM_013251342
VERSION     XM_013251342.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251342.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..597
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..597
                     /gene="LOC106086601"
                     /note="uncharacterized LOC106086601; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106086601"
     CDS             1..597
                     /gene="LOC106086601"
                     /codon_start=1
                     /product="uncharacterized protein LOC106086601"
                     /protein_id="XP_013106796.2"
                     /db_xref="GeneID:106086601"
                     /translation="MLNPTSSTFMRFYLILLVVCQHWQCIWMAADCYGMKLLSFRTTD
                     TPQYRFQMEFNSNQTLSSVTRVLEPVPTPMWNLILVQYYKQGRRTIKKNVYNTKIIVC
                     NFWRQMERLRIFNNLADNLFKDPDSGNMSLACPLQVGTYVMKNIYLPADAGLLKFIFR
                     PNTIYGLFGYVYSQLPNKKLILKCTYEINGTVIPVETC"
ORIGIN      
        1 atgttaaacc caactagctc aacttttatg cgattttatc tgatcctgct ggtggtgtgc
       61 cagcattggc aatgcatatg gatggcggcg gactgctatg gcatgaaatt gttgtcattt
      121 cgtaccaccg atactcctca atatcgtttc caaatggaat ttaattccaa tcaaacacta
      181 tcctcggtga cacgtgtgct ggagccagta cccactccca tgtggaactt gatcttggtt
      241 caatactaca aacaaggtcg acgaacaatt aagaaaaacg tttacaatac caaaataatt
      301 gtgtgtaatt tttggcgtca aatggaacgt ttacgaattt tcaataacct ggccgataat
      361 ctcttcaaag atcccgattc gggcaatatg agcctagcat gtcccttgca ggtgggcaca
      421 tatgtcatga aaaatattta cttaccggct gatgcgggac ttttgaaatt catctttcgc
      481 ccaaacacca tttatggcct ctttggctat gtctactcgc agttgccgaa taagaaattg
      541 attctcaagt gtacctatga aatcaatgga acggttatac ctgtcgaaac atgttga