PREDICTED: Stomoxys calcitrans trypsin beta (LOC106086600), mRNA.

LOCUS       XM_013251341             825 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_013251341
VERSION     XM_013251341.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251341.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..825
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..825
                     /gene="LOC106086600"
                     /note="trypsin beta; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 18 Proteins"
                     /db_xref="GeneID:106086600"
     CDS             1..825
                     /gene="LOC106086600"
                     /codon_start=1
                     /product="trypsin beta"
                     /protein_id="XP_013106795.2"
                     /db_xref="GeneID:106086600"
                     /translation="MLGFGSVLVICLLLVKGSSAGEAPSTHKRSDPRRIGIGEYTKIE
                     CAPFIVSIQRDGYHFCSGSLIAPNYVVTAGVCVFGQNTKNLMIRAGSSCTKNGGQLVP
                     VKDYLINHNFNPITKRGDIAVILLKHAVVINGVTTRTIGRPQRLQLPTSCGGGYIYGW
                     EQMRTAGFLPNTRLKRAPVLIGRQLPCGTAYRHNECSIHAGNLCAVTHNFNSCVGDIG
                     SPVVRKNLIVAVVSWCRGCAQIPLPCVLSSMSYFDAFITNATRILNDELNRVCPKP"
ORIGIN      
        1 atgttaggtt tcggtagtgt gttggtcatt tgcctgctgc tggttaaggg atcttcggct
       61 ggagaggccc cttccacgca taaacgttct gatccgaggc gcattggtat tggtgaatac
      121 accaaaatcg aatgcgctcc ctttattgtg tccatccaac gagacggtta tcacttctgc
      181 agtggttccc taatcgcccc aaactatgtg gtcaccgctg gcgtttgtgt atttggtcaa
      241 aacaccaaga accttatgat acgagccggt tcttcttgca ccaaaaacgg tggacaattg
      301 gtgccggtta aggactacct aatcaatcac aactttaatc ctataactaa acgaggtgac
      361 attgccgtca tattgctgaa acacgctgtg gtcataaacg gtgttaccac acggaccatc
      421 ggcagaccac agagacttca attgcccaca agttgtggcg gcggctatat atatggctgg
      481 gaacaaatgc gaacggcagg atttctgccc aatactcgac tgaagagggc gccggttttg
      541 attggtcgtc aactgccatg tggtacggca taccgccaca atgagtgctc aatacatgct
      601 ggaaatctgt gtgccgtaac ccacaatttt aattcttgcg ttggtgatat tggcagtcca
      661 gtggtaagga aaaatctgat tgttgccgtt gtttcctggt gcagaggctg tgctcagatt
      721 ccactgccat gcgtgctttc atcaatgtcc tatttcgatg catttatcac caacgcaaca
      781 agaatcttaa acgacgaatt gaacagagtt tgtccgaaac cctaa