Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013251270 641 bp mRNA linear INV 02-SEP-2023 (LOC106086544), mRNA. ACCESSION XM_013251270 VERSION XM_013251270.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013251270.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..641 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..641 /gene="LOC106086544" /note="uncharacterized protein CG3556-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106086544" CDS 43..522 /gene="LOC106086544" /codon_start=1 /product="uncharacterized protein CG3556-like" /protein_id="XP_013106724.2" /db_xref="GeneID:106086544" /translation="MSQSRVLSCGRLLLLGLLITHLINNAHPTNEAKNSESVAYAYTI WIGSNVTEELTILLNSPVNTNFYDAMIQAAELDSRFAFEAKDTPLGHYITSISGIKED VKKNVYWLIYCLPDHPDPNQKPGEELMSPVGVDFLIVKNGAHYLFWYRDVDLSKGAH" polyA_site 641 /gene="LOC106086544" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tatgtctatg aatgttcatt catttgttca atcatcatca tcatgagtca aagtagagtt 61 ctatcatgcg gacgtttgtt attgctgggt cttcttatta cgcatttgat taataatgcc 121 catccaacga acgaggcgaa gaattctgaa agtgttgcct atgcctacac aatatggatt 181 ggctccaatg taaccgaaga gttaacgatt ctcttgaatt cgccggttaa tacaaatttt 241 tacgacgcaa tgatccaggc agctgagctg gattccaggt ttgcatttga agctaaggac 301 actccgcttg gacattatat aacaagcatt tccggcataa aagaagacgt taagaagaat 361 gtgtactggc tgatatactg cttgccagac catccggatc caaaccaaaa acctggagaa 421 gaactgatgt ccccagtggg tgttgacttt ttgattgtta aaaacggcgc ccactacctg 481 ttttggtata gggacgttga tttatccaaa ggagctcatt aaggaagcta ttgatgacaa 541 aaagtctacc attttgccaa ttgttccaaa tagtatttct atatgatatt ctcttatata 601 aatttgcaaa atatttggta ataaattgta ttgagaacag a