Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized protein CG3556-like


LOCUS       XM_013251270             641 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086544), mRNA.
ACCESSION   XM_013251270
VERSION     XM_013251270.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251270.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..641
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..641
                     /gene="LOC106086544"
                     /note="uncharacterized protein CG3556-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:106086544"
     CDS             43..522
                     /gene="LOC106086544"
                     /codon_start=1
                     /product="uncharacterized protein CG3556-like"
                     /protein_id="XP_013106724.2"
                     /db_xref="GeneID:106086544"
                     /translation="MSQSRVLSCGRLLLLGLLITHLINNAHPTNEAKNSESVAYAYTI
                     WIGSNVTEELTILLNSPVNTNFYDAMIQAAELDSRFAFEAKDTPLGHYITSISGIKED
                     VKKNVYWLIYCLPDHPDPNQKPGEELMSPVGVDFLIVKNGAHYLFWYRDVDLSKGAH"
     polyA_site      641
                     /gene="LOC106086544"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tatgtctatg aatgttcatt catttgttca atcatcatca tcatgagtca aagtagagtt
       61 ctatcatgcg gacgtttgtt attgctgggt cttcttatta cgcatttgat taataatgcc
      121 catccaacga acgaggcgaa gaattctgaa agtgttgcct atgcctacac aatatggatt
      181 ggctccaatg taaccgaaga gttaacgatt ctcttgaatt cgccggttaa tacaaatttt
      241 tacgacgcaa tgatccaggc agctgagctg gattccaggt ttgcatttga agctaaggac
      301 actccgcttg gacattatat aacaagcatt tccggcataa aagaagacgt taagaagaat
      361 gtgtactggc tgatatactg cttgccagac catccggatc caaaccaaaa acctggagaa
      421 gaactgatgt ccccagtggg tgttgacttt ttgattgtta aaaacggcgc ccactacctg
      481 ttttggtata gggacgttga tttatccaaa ggagctcatt aaggaagcta ttgatgacaa
      541 aaagtctacc attttgccaa ttgttccaaa tagtatttct atatgatatt ctcttatata
      601 aatttgcaaa atatttggta ataaattgta ttgagaacag a