Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans LIRP-like (LOC106086464), mRNA.


LOCUS       XM_013251152            1121 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_013251152
VERSION     XM_013251152.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251152.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1121
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1121
                     /gene="LOC106086464"
                     /note="LIRP-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:106086464"
     CDS             307..690
                     /gene="LOC106086464"
                     /codon_start=1
                     /product="LIRP-like"
                     /protein_id="XP_013106606.1"
                     /db_xref="GeneID:106086464"
                     /translation="MKFSQFKISSRVLNSTASTLLVIGFIVIISLPTPAHTQPVTLHA
                     RNVPHQRYCSLSLFEAIKVICNGRYNSLSNNYPESFGNQNRASLLKRLVPDDDVIYRP
                     SFGGPVHECCRRPCGYSELQQYCAD"
     misc_feature    <619..681
                     /gene="LOC106086464"
                     /note="Insulin/insulin-like growth factor/relaxin family;
                     insulin family of proteins. Members include a number of
                     active peptides which are evolutionary related including
                     insulin, relaxin, prorelaxin, insulin-like growth factors
                     I and II, mammalian Leydig...; Region: IlGF_like; cl02453"
                     /db_xref="CDD:470583"
ORIGIN      
        1 aaaacaaaaa aggatacaac actttcctgc acctaaacct gcttcacttc actacgttaa
       61 gatcagtgtt tgaaaaattt atccaatata aagttccttc aaaaatcaag tgatgtctga
      121 aaaataagaa aaatacctat taactaaaaa gaagttcaag tattcttaaa aaaattttta
      181 taaaacttgc cagcctcaac taaagaagag aaatagaaac ttctgctaca agttcttgca
      241 actgtataat gaacaagagc cgcaccttta acttcactag gattgttcag cacgaaaacc
      301 agaaaaatga agttttccca attcaaaatc tcatcacgtg tgttaaactc tacggcgagc
      361 acactcttag tcataggctt tattgtgata atatccctac caacacctgc ccacacacaa
      421 cctgttacac tgcatgcgcg aaatgtaccg caccagcgtt actgtagttt atcgttattt
      481 gaggccatca aggtgatatg taacggacgt tacaattctc tctcaaataa ttatcccgaa
      541 agttttggca atcaaaatcg tgccagtctt ttgaaacgtt tggtaccgga tgacgatgtc
      601 atataccgac cctcatttgg tggcccagta catgaatgct gtcgccgtcc ctgtggctat
      661 tcagaactgc agcaatattg tgcggattaa ttaatttagt ttccccaacc cctcgccctc
      721 taaaatatat atgatttttt ttcataattt aagaccattc attaaggttt aaacgattca
      781 ttcattcatt cattattcaa tcatgtcata ggtttaccat attcctagcc accagcttct
      841 ttgtattacg gaatatatag gcatactttt ctgtttatgt ctcacaatgc attctttcac
      901 agttcattta ggctgtttaa agtttaagtt ccattatgtg cttatttaag ttttagatta
      961 ttacgtatgt atgttttctt tttttttttt tgttaatttt ctaacacttt aggttgtctg
     1021 tctgttgtca tatacatata tatgtcttgc tatttttcgt gtatttttaa atatattttt
     1081 ttagtaaaat gttgttagca aatttttatt ttaaaaatgg c