Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106086463


LOCUS       XM_013251151             798 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086463), mRNA.
ACCESSION   XM_013251151
VERSION     XM_013251151.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251151.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..798
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..798
                     /gene="LOC106086463"
                     /note="uncharacterized LOC106086463; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106086463"
     CDS             75..713
                     /gene="LOC106086463"
                     /codon_start=1
                     /product="uncharacterized protein LOC106086463"
                     /protein_id="XP_013106605.2"
                     /db_xref="GeneID:106086463"
                     /translation="MQLTLNARATYKNMETNYPMLLLLILLSFAKFGVQAAPMRGETT
                     FNNEIMNDVLLDLDGESPKLWDLKRKYTYNLGDEKPTEILWKKDVFEKDMDDAGLFND
                     FSVLIRSSAGSTSTSTTTTTPKPTKAGFWQRIKALICNDFDYSKAAEQSGSLLEPIVE
                     VIDDVERSETWKTVSKYASKTKDVVAENVDELGDKLIIWKDDLKDMMKKINF"
ORIGIN      
        1 tatctttttg tataaaaatt cagatatcct gaaaatgtct gctttagtat tttgccaact
       61 gcagcaaggg acgcatgcag cttaccttaa acgcaagagc aacatacaaa aatatggaaa
      121 cgaattatcc catgcttttg cttctcattc tcctatcgtt cgccaaattc ggtgtacagg
      181 ccgcaccgat gagaggtgag accacattca ataatgaaat catgaatgat gttctattgg
      241 acttggatgg ggaatcaccc aaattatggg atctcaaaag gaagtatacc tacaatctag
      301 gagatgagaa gcctactgaa atattatgga aaaaggatgt ttttgaaaag gacatggatg
      361 atgcaggatt attcaatgac tttagtgttt tgataaggag ttccgcaggc tccacctcca
      421 ccagcacaac gacaacaact cccaaaccca caaaggcagg attctggcaa agaattaaag
      481 cccttatatg caatgatttt gactactcca aggcagcgga gcaaagtggc agtcttttgg
      541 agcccatcgt tgaggtcatc gatgacgtcg aacgcagcga aacttggaaa actgtcagca
      601 aatatgcatc gaaaactaaa gatgtagtcg ccgaaaatgt tgatgagttg ggtgataaat
      661 tgataatctg gaaagatgac ttaaaggata tgatgaaaaa aattaacttc taaaaattgc
      721 agatcttata aaatttaaaa aaaaatatat ataaaaaata aaccaaaatt ttctcatttt
      781 ggaaatacca caaaaaaa