Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013251151 798 bp mRNA linear INV 02-SEP-2023 (LOC106086463), mRNA. ACCESSION XM_013251151 VERSION XM_013251151.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013251151.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..798 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..798 /gene="LOC106086463" /note="uncharacterized LOC106086463; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106086463" CDS 75..713 /gene="LOC106086463" /codon_start=1 /product="uncharacterized protein LOC106086463" /protein_id="XP_013106605.2" /db_xref="GeneID:106086463" /translation="MQLTLNARATYKNMETNYPMLLLLILLSFAKFGVQAAPMRGETT FNNEIMNDVLLDLDGESPKLWDLKRKYTYNLGDEKPTEILWKKDVFEKDMDDAGLFND FSVLIRSSAGSTSTSTTTTTPKPTKAGFWQRIKALICNDFDYSKAAEQSGSLLEPIVE VIDDVERSETWKTVSKYASKTKDVVAENVDELGDKLIIWKDDLKDMMKKINF" ORIGIN 1 tatctttttg tataaaaatt cagatatcct gaaaatgtct gctttagtat tttgccaact 61 gcagcaaggg acgcatgcag cttaccttaa acgcaagagc aacatacaaa aatatggaaa 121 cgaattatcc catgcttttg cttctcattc tcctatcgtt cgccaaattc ggtgtacagg 181 ccgcaccgat gagaggtgag accacattca ataatgaaat catgaatgat gttctattgg 241 acttggatgg ggaatcaccc aaattatggg atctcaaaag gaagtatacc tacaatctag 301 gagatgagaa gcctactgaa atattatgga aaaaggatgt ttttgaaaag gacatggatg 361 atgcaggatt attcaatgac tttagtgttt tgataaggag ttccgcaggc tccacctcca 421 ccagcacaac gacaacaact cccaaaccca caaaggcagg attctggcaa agaattaaag 481 cccttatatg caatgatttt gactactcca aggcagcgga gcaaagtggc agtcttttgg 541 agcccatcgt tgaggtcatc gatgacgtcg aacgcagcga aacttggaaa actgtcagca 601 aatatgcatc gaaaactaaa gatgtagtcg ccgaaaatgt tgatgagttg ggtgataaat 661 tgataatctg gaaagatgac ttaaaggata tgatgaaaaa aattaacttc taaaaattgc 721 agatcttata aaatttaaaa aaaaatatat ataaaaaata aaccaaaatt ttctcatttt 781 ggaaatacca caaaaaaa