Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans delta(3,5)-Delta(2,4)-dienoyl-CoA


LOCUS       XM_013251053            1276 bp    mRNA    linear   INV 02-SEP-2023
            isomerase, mitochondrial (LOC106086397), mRNA.
ACCESSION   XM_013251053
VERSION     XM_013251053.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251053.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1276
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1276
                     /gene="LOC106086397"
                     /note="delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase,
                     mitochondrial; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 12 Proteins"
                     /db_xref="GeneID:106086397"
     CDS             113..1072
                     /gene="LOC106086397"
                     /codon_start=1
                     /product="delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase,
                     mitochondrial"
                     /protein_id="XP_013106507.1"
                     /db_xref="GeneID:106086397"
                     /translation="MLLNNLRKTGMITRNLIAKSGSVSVTNQPTRAMAGILTEKVDRH
                     AEYKNLAITVPKPFVVCVELNRAKRYNAFNKEMWIEIKHCFESLHTNPDCRVIVISGA
                     GKHFSAGIDLNDMIKLGQDLADIDDVARKGHYLEPLIKLYQDSISSLENCSKPVIAAV
                     HSACIGAGIDLITAADIRYCTEDAFFSVKEVDIGMAADVGTLQRLPKAIGSQSLAREL
                     CYTGRRMESSEALSCGLVNRVFPEKEALLKAAIEMAEHIAQKSPIAVQTTKQNIVYSL
                     SRPNQEGLDQIRIMNKLYLLSEDLAQAAAAQLTKDDKPTFSKL"
     misc_feature    248..1009
                     /gene="LOC106086397"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cl23717"
                     /db_xref="CDD:474030"
     misc_feature    order(320..322,326..328,422..424,434..448,599..601,
                     605..613,677..682,689..691)
                     /gene="LOC106086397"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(440..442,611..613)
                     /gene="LOC106086397"
                     /note="oxyanion hole (OAH) forming residues [active]"
                     /db_xref="CDD:119339"
     misc_feature    order(551..553,575..577,638..649,683..694,710..712,
                     716..724,728..733,749..754,758..763,767..772,779..781,
                     812..814,821..823,869..871,878..883)
                     /gene="LOC106086397"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     polyA_site      1276
                     /gene="LOC106086397"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgacagatct cggcactgtc aatagaagat aaggccccta ctttttcatt tgtttaacgc
       61 ttgggattaa agtttttttt taatctttag ataaacaact ttgtacaaga aaatgttgtt
      121 aaataatcta cgcaaaactg ggatgataac acgcaattta atcgccaaaa gtggaagtgt
      181 gtcagtaaca aatcaaccta caagggccat ggcagggatt ttgactgaaa aggtagatcg
      241 ccatgcggag tataaaaatt tagcaattac agttccaaaa cctttcgtgg tttgtgttga
      301 gctaaatagg gccaaacgtt acaatgcatt taataaggag atgtggattg aaatcaaaca
      361 ttgctttgaa agcttgcaca ctaatccgga ttgtagagta attgtcatat caggcgccgg
      421 caaacatttc agtgcgggta ttgatttgaa tgatatgata aaactcggtc aagacttggc
      481 tgacatagat gacgttgcac gcaaagggca ctatttggag cctttaataa agttgtatca
      541 ggattctatt agctctttgg agaactgttc aaagccagta attgctgccg tacattctgc
      601 ctgcatcgga gctggtatcg acctaattac ggctgctgat attcgctatt gcacagagga
      661 tgcatttttt tctgtgaaag aagttgacat tggtatggct gctgacgtgg gaacacttca
      721 gcgtctgcca aaggccatcg gaagtcaatc gctggcaaga gagctatgtt acacaggcag
      781 acgtatggag agctccgagg ctctaagttg cggtctagtc aatcgagtat ttcccgaaaa
      841 ggaagctctc ttaaaggccg ccatagaaat ggccgagcat attgctcaaa aaagtccaat
      901 tgctgtacaa accactaagc aaaatattgt atactccctc agtcggccaa accaggaagg
      961 acttgatcaa attcgtataa tgaacaaact atacctacta tctgaagatt tggcacaagc
     1021 tgcagcggca caacttacaa aggatgataa gcccacattt tccaaactgt aaatttattt
     1081 aaatctattt atacatataa taaatatcta catcagtgca tcatttgggt taacctctcc
     1141 atgttaacgg catacacaga atgagaaggt ataagattat gatcgatgaa cgcacgttgg
     1201 cagtctttca acgtgatttc tttggtcttc ttagcttctc tgcaatatga aataaatttt
     1261 ttatacaata aatcaa