Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans TIP41-like protein (LOC106086383),


LOCUS       XM_013251039            1111 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013251039
VERSION     XM_013251039.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013251039.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1111
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1111
                     /gene="LOC106086383"
                     /note="TIP41-like protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 8
                     Proteins"
                     /db_xref="GeneID:106086383"
     CDS             126..938
                     /gene="LOC106086383"
                     /codon_start=1
                     /product="TIP41-like protein"
                     /protein_id="XP_013106493.2"
                     /db_xref="GeneID:106086383"
                     /translation="MEDELVPRLPVDQEEIDFHDWHIAYFKSHILKSICAKGQDAHCK
                     EGDDYCELCTYQNALELPHLPDMVFHKNKLCLQHRDGATLEFLPIDALRLVENGKQPL
                     QVACAQEWKESRPESLMEEKFKPFDWTFTTDYQGTANEKFRIEKSDQHLNKFKLMQRE
                     KILFYHDLTLFEDELHDNGISSSSVKIRVMPSGFFILLRHFLRVDNVLLKIHDTRFHY
                     EVGNDFIFKEYTKRAATYEELKNVPPAYFTIPNEIEQHMPINEKLAYNLYFK"
     polyA_site      1111
                     /gene="LOC106086383"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gttgattctt ttggtaatgc ttttgttttt ttttaagaaa ccgccggtag agccttcagg
       61 attacattta tcataaaaaa ttaacagtgc tacagttctt aaatcgcaaa ttatagttcg
      121 tcttaatgga ggatgaacta gtacctcgat tacccgtcga ccaggaggag atcgattttc
      181 atgactggca catagcttac ttcaaatcgc atatacttaa aagtatttgt gcgaagggtc
      241 aagatgccca ctgcaaggaa ggagatgact attgcgaact ttgtacttat caaaatgcat
      301 tggagctacc acatctgcca gatatggttt ttcacaaaaa taagctatgt ttgcaacatc
      361 gggatggtgc aactcttgaa tttttaccca tcgatgctct acgtttggtt gaaaacggca
      421 aacaaccact gcaggtagct tgtgctcagg agtggaaaga aagtcgaccg gaaagcttaa
      481 tggaggaaaa atttaaacct ttcgattgga ctttcactac agactatcag ggaactgcca
      541 acgagaaatt tcgtatagaa aaatccgacc aacatctaaa caaatttaaa ttaatgcaac
      601 gtgagaaaat acttttctat catgatttaa cactttttga agacgagcta cacgacaatg
      661 gaatatcatc ctcatcagta aaaattaggg ttatgccttc gggattcttc atactgttaa
      721 gacatttttt gcgtgtggac aatgttttgc tgaaaattca tgatactcgt tttcactacg
      781 aagtaggaaa tgacttcata tttaaggagt atactaaacg cgctgcaact tatgaagagt
      841 tgaagaatgt accacccgcc tactttacca tccccaatga aattgaacaa catatgccaa
      901 taaatgaaaa attggcatac aatctgtatt tcaaataacg attagtgcac aaaaactttt
      961 agcgttaact ttggtaaatc gccaaattta taaataacta cccaaccata aaattaactt
     1021 gaaacgtcat ctatgatatg ttgtaatttc tttaaaaata atgtatttat acaaaataaa
     1081 acaatacttg tcatgcaata taaaaagcaa a