Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013251039 1111 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013251039 VERSION XM_013251039.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013251039.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1111 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1111 /gene="LOC106086383" /note="TIP41-like protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:106086383" CDS 126..938 /gene="LOC106086383" /codon_start=1 /product="TIP41-like protein" /protein_id="XP_013106493.2" /db_xref="GeneID:106086383" /translation="MEDELVPRLPVDQEEIDFHDWHIAYFKSHILKSICAKGQDAHCK EGDDYCELCTYQNALELPHLPDMVFHKNKLCLQHRDGATLEFLPIDALRLVENGKQPL QVACAQEWKESRPESLMEEKFKPFDWTFTTDYQGTANEKFRIEKSDQHLNKFKLMQRE KILFYHDLTLFEDELHDNGISSSSVKIRVMPSGFFILLRHFLRVDNVLLKIHDTRFHY EVGNDFIFKEYTKRAATYEELKNVPPAYFTIPNEIEQHMPINEKLAYNLYFK" polyA_site 1111 /gene="LOC106086383" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gttgattctt ttggtaatgc ttttgttttt ttttaagaaa ccgccggtag agccttcagg 61 attacattta tcataaaaaa ttaacagtgc tacagttctt aaatcgcaaa ttatagttcg 121 tcttaatgga ggatgaacta gtacctcgat tacccgtcga ccaggaggag atcgattttc 181 atgactggca catagcttac ttcaaatcgc atatacttaa aagtatttgt gcgaagggtc 241 aagatgccca ctgcaaggaa ggagatgact attgcgaact ttgtacttat caaaatgcat 301 tggagctacc acatctgcca gatatggttt ttcacaaaaa taagctatgt ttgcaacatc 361 gggatggtgc aactcttgaa tttttaccca tcgatgctct acgtttggtt gaaaacggca 421 aacaaccact gcaggtagct tgtgctcagg agtggaaaga aagtcgaccg gaaagcttaa 481 tggaggaaaa atttaaacct ttcgattgga ctttcactac agactatcag ggaactgcca 541 acgagaaatt tcgtatagaa aaatccgacc aacatctaaa caaatttaaa ttaatgcaac 601 gtgagaaaat acttttctat catgatttaa cactttttga agacgagcta cacgacaatg 661 gaatatcatc ctcatcagta aaaattaggg ttatgccttc gggattcttc atactgttaa 721 gacatttttt gcgtgtggac aatgttttgc tgaaaattca tgatactcgt tttcactacg 781 aagtaggaaa tgacttcata tttaaggagt atactaaacg cgctgcaact tatgaagagt 841 tgaagaatgt accacccgcc tactttacca tccccaatga aattgaacaa catatgccaa 901 taaatgaaaa attggcatac aatctgtatt tcaaataacg attagtgcac aaaaactttt 961 agcgttaact ttggtaaatc gccaaattta taaataacta cccaaccata aaattaactt 1021 gaaacgtcat ctatgatatg ttgtaatttc tttaaaaata atgtatttat acaaaataaa 1081 acaatacttg tcatgcaata taaaaagcaa a