Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250926 542 bp mRNA linear INV 02-SEP-2023 (LOC106086304), transcript variant X1, mRNA. ACCESSION XM_013250926 VERSION XM_013250926.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250926.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..542 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..542 /gene="LOC106086304" /note="large ribosomal subunit protein eL36; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 33 Proteins" /db_xref="GeneID:106086304" CDS 73..420 /gene="LOC106086304" /codon_start=1 /product="large ribosomal subunit protein eL36" /protein_id="XP_013106380.1" /db_xref="GeneID:106086304" /translation="MAVRYELCVGLNKGHKTTKIKNVKYTGTKKVKGLRGARLKNIQT RHTKFMRDLVREVVGHAPYEKRTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSN ILTQMRKAQTHAK" misc_feature 82..399 /gene="LOC106086304" /note="Ribosomal protein L36e; Region: Ribosomal_L36e; pfam01158" /db_xref="CDD:460088" polyA_site 542 /gene="LOC106086304" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ggcctaaaaa tggcgaccaa acaaaatgcg ctgtcaaagc tctttccgcc ttttgacaat 61 tgctaaggca aaatggcagt acgctacgaa ctctgtgttg gtctcaacaa gggtcacaag 121 accaccaaaa taaagaatgt taaatacaca ggaaccaaga aagtcaaagg cttgcgtggt 181 gctcgtttga agaacatcca aacccgccac actaaattca tgcgtgactt ggtccgtgaa 241 gttgttggtc atgctcccta tgagaagaga actatggaat tgttgaaggt atctaaggat 301 aagcgtgctt tgaaattctt gaaacgccga ttgggcacac acatccgcgc caagaggaag 361 cgtgaagaat tgtccaacat tctcactcaa atgagaaagg ctcaaactca cgccaagtaa 421 ataaagaact ggctgtgatc tgagttcatc tatgtttagt gtttacgcta ttctggattt 481 ttactttgac agtagtggta atgataaaca aaaaattaat aaaaacagaa aattaaaatg 541 ta