Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans small nuclear ribonucleoprotein F


LOCUS       XM_013250922             524 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086302), mRNA.
ACCESSION   XM_013250922
VERSION     XM_013250922.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250922.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..524
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..524
                     /gene="LOC106086302"
                     /note="small nuclear ribonucleoprotein F; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 10 Proteins"
                     /db_xref="GeneID:106086302"
     CDS             102..368
                     /gene="LOC106086302"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein F"
                     /protein_id="XP_013106376.1"
                     /db_xref="GeneID:106086302"
                     /translation="MSAAMPINPKPFLNGLTGKAVIIKLKWGHEYKGYLVSVDGYMNM
                     QLANTEEHIDGQVTGNLGEVLIRCNNVLYIKGVDDEDEEGEMRD"
     misc_feature    123..329
                     /gene="LOC106086302"
                     /note="Sm protein F; Region: Sm_F; cd01722"
                     /db_xref="CDD:212469"
     misc_feature    order(123..128,138..140,171..182,192..194,216..218,
                     222..233,282..329)
                     /gene="LOC106086302"
                     /note="heptamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212469"
     misc_feature    order(162..182,186..224,228..242)
                     /gene="LOC106086302"
                     /note="Sm1 motif; other site"
                     /db_xref="CDD:212469"
     misc_feature    order(171..173,177..182,189..191,219..230,300..311)
                     /gene="LOC106086302"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:212469"
     misc_feature    288..323
                     /gene="LOC106086302"
                     /note="Sm2 motif; other site"
                     /db_xref="CDD:212469"
     polyA_site      524
                     /gene="LOC106086302"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cagttacaaa aaacgtgtgg cagtgttctc ttctcgagcg tgtttatagc cgggtaattt
       61 ttgttttgtg ttttagcaaa taatagaatt atattgtaac catgtctgct gctatgccaa
      121 taaatcccaa accatttctt aatggtttaa cgggtaaagc agttataatt aaactcaagt
      181 ggggacatga atacaaaggc tatctggtgt cagttgatgg atacatgaac atgcaattgg
      241 ccaatactga ggaacacatt gatggacaag ttactggtaa cttgggagaa gttcttatac
      301 gttgcaataa cgtcctgtat attaaaggtg tcgatgacga ggatgaagaa ggcgaaatga
      361 gagactaagc tcatcgacat taactatgct ccataatcta gtttgtaata tacaaatttc
      421 ccgctaatgt atagaaaacc aaatccactt ttgtatcttg taagtcaaaa ttacatttct
      481 aacaaataaa gatcgattga aatgtatgaa tagtaaagaa aata