Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250922 524 bp mRNA linear INV 02-SEP-2023 (LOC106086302), mRNA. ACCESSION XM_013250922 VERSION XM_013250922.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250922.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..524 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..524 /gene="LOC106086302" /note="small nuclear ribonucleoprotein F; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106086302" CDS 102..368 /gene="LOC106086302" /codon_start=1 /product="small nuclear ribonucleoprotein F" /protein_id="XP_013106376.1" /db_xref="GeneID:106086302" /translation="MSAAMPINPKPFLNGLTGKAVIIKLKWGHEYKGYLVSVDGYMNM QLANTEEHIDGQVTGNLGEVLIRCNNVLYIKGVDDEDEEGEMRD" misc_feature 123..329 /gene="LOC106086302" /note="Sm protein F; Region: Sm_F; cd01722" /db_xref="CDD:212469" misc_feature order(123..128,138..140,171..182,192..194,216..218, 222..233,282..329) /gene="LOC106086302" /note="heptamer interface [polypeptide binding]; other site" /db_xref="CDD:212469" misc_feature order(162..182,186..224,228..242) /gene="LOC106086302" /note="Sm1 motif; other site" /db_xref="CDD:212469" misc_feature order(171..173,177..182,189..191,219..230,300..311) /gene="LOC106086302" /note="RNA binding site [nucleotide binding]; other site" /db_xref="CDD:212469" misc_feature 288..323 /gene="LOC106086302" /note="Sm2 motif; other site" /db_xref="CDD:212469" polyA_site 524 /gene="LOC106086302" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cagttacaaa aaacgtgtgg cagtgttctc ttctcgagcg tgtttatagc cgggtaattt 61 ttgttttgtg ttttagcaaa taatagaatt atattgtaac catgtctgct gctatgccaa 121 taaatcccaa accatttctt aatggtttaa cgggtaaagc agttataatt aaactcaagt 181 ggggacatga atacaaaggc tatctggtgt cagttgatgg atacatgaac atgcaattgg 241 ccaatactga ggaacacatt gatggacaag ttactggtaa cttgggagaa gttcttatac 301 gttgcaataa cgtcctgtat attaaaggtg tcgatgacga ggatgaagaa ggcgaaatga 361 gagactaagc tcatcgacat taactatgct ccataatcta gtttgtaata tacaaatttc 421 ccgctaatgt atagaaaacc aaatccactt ttgtatcttg taagtcaaaa ttacatttct 481 aacaaataaa gatcgattga aatgtatgaa tagtaaagaa aata