Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250792 809 bp mRNA linear INV 02-SEP-2023 (LOC106086218), transcript variant X1, mRNA. ACCESSION XM_013250792 VERSION XM_013250792.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250792.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..809 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..809 /gene="LOC106086218" /note="uncharacterized LOC106086218; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106086218" CDS 37..747 /gene="LOC106086218" /codon_start=1 /product="uncharacterized protein LOC106086218 isoform X1" /protein_id="XP_013106246.2" /db_xref="GeneID:106086218" /translation="MYGYHDFNKLEIANWYKFKIFNVQYFHNSNSFQRILKFKNSIVE MNLPRNVQIEVLILNFCIGMGLSRYGQHTWEYELISMDSYSSDTDLVLFYELNATRAS RGVYACAGTMFLNYDVVEGDSNEIEVKTYRSDSINGDYKPIPFSIQRQHIFEFMNNFY KNALMETLKDCSNLPVFKGDFVPPLEKRNYTLDNCVFTQEGFPHHIQDGYYKIAFNAF GDVEWSMIFYAIVENILR" polyA_site 809 /gene="LOC106086218" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aatttaattc aatacaacgt gttattaatt gcctcgatgt atggatatca tgattttaac 61 aaattagaaa ttgccaactg gtataaattc aaaattttca atgttcagta ctttcacaac 121 tcaaactcat ttcaaagaat attgaaattt aaaaattcaa ttgttgaaat gaatctaccc 181 agaaatgttc aaattgaagt tttgatactt aatttttgta ttggcatggg attatcccgt 241 tatggccagc atacttggga atacgagctg atctcaatgg atagttattc ctctgatacc 301 gacttagtgc tgttctatga actgaatgcg actagagcca gtcgtggagt ttacgcttgc 361 gcaggaacga tgtttctcaa ttatgacgta gtagaaggtg actccaatga gatagaagta 421 aaaacgtacc gaagtgacag cataaacggg gattataagc ccataccctt ctctatacag 481 aggcagcata tttttgagtt tatgaacaat ttctataaga atgcattgat ggaaacacta 541 aaggattgtt cgaatttgcc ggtattcaag ggggattttg tgccaccttt agagaagaga 601 aattacacat tggacaattg tgtttttacc caagagggat ttccccacca tatacaggat 661 ggttactaca agatcgcctt taatgccttc ggcgatgttg agtggtcaat gattttttat 721 gccatagttg agaacatttt acgatagata caaattgcgc acagattgat ttttatgatt 781 tttaaaaaat aaattctcag tgcaaacaa