Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106086218


LOCUS       XM_013250792             809 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086218), transcript variant X1, mRNA.
ACCESSION   XM_013250792
VERSION     XM_013250792.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250792.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..809
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..809
                     /gene="LOC106086218"
                     /note="uncharacterized LOC106086218; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106086218"
     CDS             37..747
                     /gene="LOC106086218"
                     /codon_start=1
                     /product="uncharacterized protein LOC106086218 isoform X1"
                     /protein_id="XP_013106246.2"
                     /db_xref="GeneID:106086218"
                     /translation="MYGYHDFNKLEIANWYKFKIFNVQYFHNSNSFQRILKFKNSIVE
                     MNLPRNVQIEVLILNFCIGMGLSRYGQHTWEYELISMDSYSSDTDLVLFYELNATRAS
                     RGVYACAGTMFLNYDVVEGDSNEIEVKTYRSDSINGDYKPIPFSIQRQHIFEFMNNFY
                     KNALMETLKDCSNLPVFKGDFVPPLEKRNYTLDNCVFTQEGFPHHIQDGYYKIAFNAF
                     GDVEWSMIFYAIVENILR"
     polyA_site      809
                     /gene="LOC106086218"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aatttaattc aatacaacgt gttattaatt gcctcgatgt atggatatca tgattttaac
       61 aaattagaaa ttgccaactg gtataaattc aaaattttca atgttcagta ctttcacaac
      121 tcaaactcat ttcaaagaat attgaaattt aaaaattcaa ttgttgaaat gaatctaccc
      181 agaaatgttc aaattgaagt tttgatactt aatttttgta ttggcatggg attatcccgt
      241 tatggccagc atacttggga atacgagctg atctcaatgg atagttattc ctctgatacc
      301 gacttagtgc tgttctatga actgaatgcg actagagcca gtcgtggagt ttacgcttgc
      361 gcaggaacga tgtttctcaa ttatgacgta gtagaaggtg actccaatga gatagaagta
      421 aaaacgtacc gaagtgacag cataaacggg gattataagc ccataccctt ctctatacag
      481 aggcagcata tttttgagtt tatgaacaat ttctataaga atgcattgat ggaaacacta
      541 aaggattgtt cgaatttgcc ggtattcaag ggggattttg tgccaccttt agagaagaga
      601 aattacacat tggacaattg tgtttttacc caagagggat ttccccacca tatacaggat
      661 ggttactaca agatcgcctt taatgccttc ggcgatgttg agtggtcaat gattttttat
      721 gccatagttg agaacatttt acgatagata caaattgcgc acagattgat ttttatgatt
      781 tttaaaaaat aaattctcag tgcaaacaa