Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans fibrinogen C domain-containing


LOCUS       XM_013250533             769 bp    mRNA    linear   INV 02-SEP-2023
            protein 1-like (LOC106086029), mRNA.
ACCESSION   XM_013250533
VERSION     XM_013250533.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250533.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..769
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..769
                     /gene="LOC106086029"
                     /note="fibrinogen C domain-containing protein 1-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 4 Proteins"
                     /db_xref="GeneID:106086029"
     CDS             30..692
                     /gene="LOC106086029"
                     /codon_start=1
                     /product="fibrinogen C domain-containing protein 1-like"
                     /protein_id="XP_013105987.2"
                     /db_xref="GeneID:106086029"
                     /translation="MWKWFCLIFVIFCALLVVLHAFQGNEEEEDIKAPNSMLEELQSS
                     NWTSIQRRQDGSVNFYRNWAEYKEGFGDAPNGEFFLGLQKIHEFTSQTPQELLIVLKD
                     WDNNTRFALYDHFEIGNESEFYSLKNLGKYQGNAGDDLNSYKGMKFSTYDSDNDIDES
                     SNCAELFDGAWWFTDCGLGNVNGPYLKGDDVNKDDGVTWDAWKGAYYSLQFSEMKLRP
                     KQ"
     polyA_site      769
                     /gene="LOC106086029"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtgctgaatc ttagacacga ttttgaatca tgtggaagtg gttttgttta atttttgtga
       61 ttttttgtgc gctcctagtg gttttgcatg cattccaagg caatgaagaa gaagaagaca
      121 taaaagctcc gaattccatg ttggaggagc tccaatcttc aaattggact tccattcagc
      181 ggcgtcaaga tggctctgtg aatttctatc gcaactgggc agaatacaaa gagggctttg
      241 gtgatgctcc aaatggtgaa ttcttcttgg gtttacaaaa aatccatgaa tttacctccc
      301 agactccaca agaactgttg attgtactaa aagattggga caataatact cgttttgccc
      361 tgtatgacca ctttgaaatt ggcaatgaat ctgaatttta ttctctaaag aacttgggta
      421 aatatcaggg gaacgctggt gatgatttga attcctataa aggcatgaaa ttttccacct
      481 atgattctga caatgacatc gatgagagct ctaattgtgc ggaacttttc gatggggcat
      541 ggtggtttac agattgcggt cttggcaatg tgaatggacc ctatttgaaa ggagatgatg
      601 tgaataagga tgatggtgtc acctgggatg catggaaagg cgcctattat tcgttacaat
      661 tttcagagat gaaactacgt ccgaagcagt aagaaattag gaattaaata ataaaatccc
      721 taagttgtgt cttaattttt caaacaataa aatcaaattt caattgtca