Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250532 824 bp mRNA linear INV 02-SEP-2023 protein 1-A (LOC106086028), mRNA. ACCESSION XM_013250532 VERSION XM_013250532.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250532.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..824 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..824 /gene="LOC106086028" /note="fibrinogen C domain-containing protein 1-A; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106086028" CDS 39..824 /gene="LOC106086028" /codon_start=1 /product="fibrinogen C domain-containing protein 1-A" /protein_id="XP_013105986.2" /db_xref="GeneID:106086028" /translation="MRRLNLILFTLCAGLAVCAANSPLDDKFDRLSDKIIRIEHMNQA LRDRIDSLAVQFESIVKRNYAQEALLAEYQQSDWTTIQRRQDGSVDFYRNWTEYKNGF GDAPHGEFFVGLQKLHELTSQKPHELLIVLKDWDNDTRYAIYDKFEIGSEQEQYSLKD LGEYRGNAGDALEYYKGSKFSTLDVDNDEDENTNCAKLFKGGWWFKSCCLSDLNGPYL TENYNIEDGVTWYDWRGLNYSLKFAEMKIRSKKNLKKKSIDVR" ORIGIN 1 aagttttgat acatcagaaa atacggctat caatagagat gaggaggcta aatttaattc 61 tttttacact gtgtgctgga ttggccgttt gtgctgcgaa ttcacccctc gacgacaaat 121 tcgatcgtct ttcggacaaa attattcgaa ttgagcacat gaatcaagca cttagggata 181 gaattgattc attggcagtc caatttgaga gtatagtaaa gagaaattat gcccaggaag 241 ccttattagc tgaatatcaa caatctgatt ggactaccat acagcgacgt caagatggct 301 ctgtggattt ctaccgcaat tggaccgaat acaaaaatgg ttttggtgat gcaccccatg 361 gcgaattctt tgtgggtctg caaaaacttc atgaacttac ttcacaaaaa ccccatgaac 421 ttttgattgt cttgaaagat tgggataatg atacacgtta tgccatctat gataaatttg 481 aaattggcag tgagcaagaa caatattccc tcaaagattt gggtgaatat cgtggtaatg 541 ctggtgatgc tttggaatac tacaagggca gtaaattttc caccctagat gtggacaatg 601 atgaagatga aaataccaat tgtgcaaagc tattcaaagg aggttggtgg ttcaagtcat 661 gttgcttaag tgatttgaat ggcccttatt taactgaaaa ttataatatt gaagatggtg 721 taacttggta tgactggaga ggtttgaatt actctttgaa atttgctgaa atgaaaattc 781 gttccaagaa aaatttaaaa aaaaaatcaa tagatgttcg ataa