Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans fibrinogen C domain-containing


LOCUS       XM_013250532             824 bp    mRNA    linear   INV 02-SEP-2023
            protein 1-A (LOC106086028), mRNA.
ACCESSION   XM_013250532
VERSION     XM_013250532.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250532.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..824
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..824
                     /gene="LOC106086028"
                     /note="fibrinogen C domain-containing protein 1-A; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 10 Proteins"
                     /db_xref="GeneID:106086028"
     CDS             39..824
                     /gene="LOC106086028"
                     /codon_start=1
                     /product="fibrinogen C domain-containing protein 1-A"
                     /protein_id="XP_013105986.2"
                     /db_xref="GeneID:106086028"
                     /translation="MRRLNLILFTLCAGLAVCAANSPLDDKFDRLSDKIIRIEHMNQA
                     LRDRIDSLAVQFESIVKRNYAQEALLAEYQQSDWTTIQRRQDGSVDFYRNWTEYKNGF
                     GDAPHGEFFVGLQKLHELTSQKPHELLIVLKDWDNDTRYAIYDKFEIGSEQEQYSLKD
                     LGEYRGNAGDALEYYKGSKFSTLDVDNDEDENTNCAKLFKGGWWFKSCCLSDLNGPYL
                     TENYNIEDGVTWYDWRGLNYSLKFAEMKIRSKKNLKKKSIDVR"
ORIGIN      
        1 aagttttgat acatcagaaa atacggctat caatagagat gaggaggcta aatttaattc
       61 tttttacact gtgtgctgga ttggccgttt gtgctgcgaa ttcacccctc gacgacaaat
      121 tcgatcgtct ttcggacaaa attattcgaa ttgagcacat gaatcaagca cttagggata
      181 gaattgattc attggcagtc caatttgaga gtatagtaaa gagaaattat gcccaggaag
      241 ccttattagc tgaatatcaa caatctgatt ggactaccat acagcgacgt caagatggct
      301 ctgtggattt ctaccgcaat tggaccgaat acaaaaatgg ttttggtgat gcaccccatg
      361 gcgaattctt tgtgggtctg caaaaacttc atgaacttac ttcacaaaaa ccccatgaac
      421 ttttgattgt cttgaaagat tgggataatg atacacgtta tgccatctat gataaatttg
      481 aaattggcag tgagcaagaa caatattccc tcaaagattt gggtgaatat cgtggtaatg
      541 ctggtgatgc tttggaatac tacaagggca gtaaattttc caccctagat gtggacaatg
      601 atgaagatga aaataccaat tgtgcaaagc tattcaaagg aggttggtgg ttcaagtcat
      661 gttgcttaag tgatttgaat ggcccttatt taactgaaaa ttataatatt gaagatggtg
      721 taacttggta tgactggaga ggtttgaatt actctttgaa atttgctgaa atgaaaattc
      781 gttccaagaa aaatttaaaa aaaaaatcaa tagatgttcg ataa