Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans fibrinogen C domain-containing


LOCUS       XM_013250531             970 bp    mRNA    linear   INV 02-SEP-2023
            protein 1 (LOC106086026), mRNA.
ACCESSION   XM_013250531
VERSION     XM_013250531.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250531.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..970
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..970
                     /gene="LOC106086026"
                     /note="fibrinogen C domain-containing protein 1; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:106086026"
     CDS             104..895
                     /gene="LOC106086026"
                     /codon_start=1
                     /product="fibrinogen C domain-containing protein 1"
                     /protein_id="XP_013105985.2"
                     /db_xref="GeneID:106086026"
                     /translation="MMSRLKLALLILFAGLKVCASIPLNDDGSESTTEAEKLTWEGLY
                     AIHDNLVHEAKQLNEQLNELEKIIANLTKISTAQEALIVEYQISDWTTIENRMDGSVD
                     FNRSWQEYKNGFGNPPAGEFFVGLQKLHELSTEKPYELLIVLKHWEDDETRYAHYDHF
                     EIGSEQEKYALKNLGQYSGNAGDSLTTLKDAKFSTSDADNEEKNCAQYYKAAWWFKTS
                     CVAGLHGPYRTEYEADYMDGISWLKWTGEDYSLKSVQIKIRPKRN"
ORIGIN      
        1 aattcaaaac caaatcaaat attttgtcaa tcttgaagtg tgctattaaa taaaagtctc
       61 atgtgaaaaa aattgtcagt ctattaaggg aatcgtttct aatatgatga gcagattaaa
      121 attggcattg ttgattttgt ttgccggatt gaaagtgtgt gccagtatac ccttaaatga
      181 tgatggctct gaatctacta ctgaagccga aaaactaact tgggaaggcc tttatgccat
      241 acacgacaat ctggtgcacg aagccaagca attaaatgaa caactaaacg agttggagaa
      301 aataattgca aatctaacga aaatttccac tgcccaggaa gcccttatcg tggaatacca
      361 aatttccgat tggactacca ttgaaaatcg catggatggc tcggttgatt tcaatcgcag
      421 ttggcaagaa tataaaaatg gttttggcaa tccaccagct ggagaatttt ttgtaggcct
      481 acaaaaactt catgaactta gcactgagaa accttacgag ctcttgattg tattgaaaca
      541 ttgggaggac gatgaaaccc gttatgctca ctatgatcac tttgaaatcg gcagtgagca
      601 ggagaaatat gctctgaaaa acttaggtca atatagtggc aatgctggtg attccctaac
      661 gactttaaag gatgccaaat tttccacctc tgatgcggat aacgaagaga aaaattgtgc
      721 ccaatattac aaagccgcat ggtggtttaa gacgtcgtgc gttgcaggtt tgcatgggcc
      781 ttaccgaacg gagtatgaag ctgattatat ggatggcatc agctggctta aatggacggg
      841 agaggattat tcattgaaat ctgttcagat taaaatacgc cctaagagaa actgaaagac
      901 ggaaatttat aaaaaatgtt ttcaaatttt ttaaaaaaaa aatttaaaaa ttttgcgctg
      961 aataaataag