Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250531 970 bp mRNA linear INV 02-SEP-2023 protein 1 (LOC106086026), mRNA. ACCESSION XM_013250531 VERSION XM_013250531.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250531.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..970 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..970 /gene="LOC106086026" /note="fibrinogen C domain-containing protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106086026" CDS 104..895 /gene="LOC106086026" /codon_start=1 /product="fibrinogen C domain-containing protein 1" /protein_id="XP_013105985.2" /db_xref="GeneID:106086026" /translation="MMSRLKLALLILFAGLKVCASIPLNDDGSESTTEAEKLTWEGLY AIHDNLVHEAKQLNEQLNELEKIIANLTKISTAQEALIVEYQISDWTTIENRMDGSVD FNRSWQEYKNGFGNPPAGEFFVGLQKLHELSTEKPYELLIVLKHWEDDETRYAHYDHF EIGSEQEKYALKNLGQYSGNAGDSLTTLKDAKFSTSDADNEEKNCAQYYKAAWWFKTS CVAGLHGPYRTEYEADYMDGISWLKWTGEDYSLKSVQIKIRPKRN" ORIGIN 1 aattcaaaac caaatcaaat attttgtcaa tcttgaagtg tgctattaaa taaaagtctc 61 atgtgaaaaa aattgtcagt ctattaaggg aatcgtttct aatatgatga gcagattaaa 121 attggcattg ttgattttgt ttgccggatt gaaagtgtgt gccagtatac ccttaaatga 181 tgatggctct gaatctacta ctgaagccga aaaactaact tgggaaggcc tttatgccat 241 acacgacaat ctggtgcacg aagccaagca attaaatgaa caactaaacg agttggagaa 301 aataattgca aatctaacga aaatttccac tgcccaggaa gcccttatcg tggaatacca 361 aatttccgat tggactacca ttgaaaatcg catggatggc tcggttgatt tcaatcgcag 421 ttggcaagaa tataaaaatg gttttggcaa tccaccagct ggagaatttt ttgtaggcct 481 acaaaaactt catgaactta gcactgagaa accttacgag ctcttgattg tattgaaaca 541 ttgggaggac gatgaaaccc gttatgctca ctatgatcac tttgaaatcg gcagtgagca 601 ggagaaatat gctctgaaaa acttaggtca atatagtggc aatgctggtg attccctaac 661 gactttaaag gatgccaaat tttccacctc tgatgcggat aacgaagaga aaaattgtgc 721 ccaatattac aaagccgcat ggtggtttaa gacgtcgtgc gttgcaggtt tgcatgggcc 781 ttaccgaacg gagtatgaag ctgattatat ggatggcatc agctggctta aatggacggg 841 agaggattat tcattgaaat ctgttcagat taaaatacgc cctaagagaa actgaaagac 901 ggaaatttat aaaaaatgtt ttcaaatttt ttaaaaaaaa aatttaaaaa ttttgcgctg 961 aataaataag