Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250517 651 bp mRNA linear INV 02-SEP-2023 (LOC106086016), mRNA. ACCESSION XM_013250517 VERSION XM_013250517.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250517.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..651 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..651 /gene="LOC106086016" /note="uncharacterized LOC106086016; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106086016" CDS 211..570 /gene="LOC106086016" /codon_start=1 /product="uncharacterized protein LOC106086016" /protein_id="XP_013105971.1" /db_xref="GeneID:106086016" /translation="MKCIASVALILALAVSCQGYSFFIPAKIGMPGVCMYNGIMLKRG DNNVMNSCQNMRCNEDGSIVVQGCGHYDMRDCKVLDPMNLHKPYPDCCRMNFLCTMAN GEVVNREIQPLETGIYA" misc_feature <358..489 /gene="LOC106086016" /note="Single domain von Willebrand factor type C; Region: SVWC; pfam15430" /db_xref="CDD:464713" polyA_site 651 /gene="LOC106086016" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcatcaaaat acgaaatcaa gtagctcata aaaagttcat tgaatttttg catttcttca 61 aaacatttcc atatggaacg ataagctgga aggcaaattt gtcataacac atttttttct 121 tataaaaacc ttttaaagag tttatgtgcc atcagttatt tccaaagatt tgtaaaatat 181 acagctgaga gtgatttaaa gcaacctaca atgaagtgca tcgcatctgt ggcattaatc 241 ctggctttgg ctgtctcatg tcaaggatat agcttcttta taccagcaaa aattggtatg 301 cccggagtat gcatgtacaa tggaataatg ctaaagcgtg gtgacaataa tgtgatgaat 361 tcatgccaaa acatgcgctg caatgaggat ggatccattg tagtacaagg atgcggtcat 421 tatgatatgc gcgattgtaa ggttctggac cccatgaatt tacacaaacc ttatccggat 481 tgttgccgca tgaatttcct gtgcaccatg gccaatggag aagtggtaaa tcgtgaaatt 541 caacctttgg aaactggtat atatgcttaa tttactagat tttaagtaaa ttttgaaaca 601 tttgtaaagg agataattaa ggaggaataa aaatgttctg ttcatatatt a