Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106086016


LOCUS       XM_013250517             651 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086016), mRNA.
ACCESSION   XM_013250517
VERSION     XM_013250517.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250517.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..651
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..651
                     /gene="LOC106086016"
                     /note="uncharacterized LOC106086016; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106086016"
     CDS             211..570
                     /gene="LOC106086016"
                     /codon_start=1
                     /product="uncharacterized protein LOC106086016"
                     /protein_id="XP_013105971.1"
                     /db_xref="GeneID:106086016"
                     /translation="MKCIASVALILALAVSCQGYSFFIPAKIGMPGVCMYNGIMLKRG
                     DNNVMNSCQNMRCNEDGSIVVQGCGHYDMRDCKVLDPMNLHKPYPDCCRMNFLCTMAN
                     GEVVNREIQPLETGIYA"
     misc_feature    <358..489
                     /gene="LOC106086016"
                     /note="Single domain von Willebrand factor type C; Region:
                     SVWC; pfam15430"
                     /db_xref="CDD:464713"
     polyA_site      651
                     /gene="LOC106086016"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcatcaaaat acgaaatcaa gtagctcata aaaagttcat tgaatttttg catttcttca
       61 aaacatttcc atatggaacg ataagctgga aggcaaattt gtcataacac atttttttct
      121 tataaaaacc ttttaaagag tttatgtgcc atcagttatt tccaaagatt tgtaaaatat
      181 acagctgaga gtgatttaaa gcaacctaca atgaagtgca tcgcatctgt ggcattaatc
      241 ctggctttgg ctgtctcatg tcaaggatat agcttcttta taccagcaaa aattggtatg
      301 cccggagtat gcatgtacaa tggaataatg ctaaagcgtg gtgacaataa tgtgatgaat
      361 tcatgccaaa acatgcgctg caatgaggat ggatccattg tagtacaagg atgcggtcat
      421 tatgatatgc gcgattgtaa ggttctggac cccatgaatt tacacaaacc ttatccggat
      481 tgttgccgca tgaatttcct gtgcaccatg gccaatggag aagtggtaaa tcgtgaaatt
      541 caacctttgg aaactggtat atatgcttaa tttactagat tttaagtaaa ttttgaaaca
      601 tttgtaaagg agataattaa ggaggaataa aaatgttctg ttcatatatt a